Mesitornis unicolor (brown roatelo): 104544126 Help Entry 104544126         CDS       T08455                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04010   MAPK signaling pathway mui04020   Calcium signaling pathway mui04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104544126 (FGF2)    04020 Calcium signaling pathway     104544126 (FGF2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104544126 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mui04052]     104544126 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:mui00536]     104544126 (FGF2) Cytokines and neuropeptides [BR:mui04052]  Cytokines   Growth factors (RTK binding)    104544126 (FGF2) Glycosaminoglycan binding proteins [BR:mui00536]  Heparan sulfate / Heparin   Growth factors/receptors    104544126 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 WD40_RFWD3 Fascin Motif Other DBs NCBI-GeneID:  104544126 NCBI-ProteinID:  XP_010187194 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search ALLAEEEHMSAVIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERL ESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS NT seq 328 nt NT seq  +upstreamnt  +downstreamnt agctctgctggcagaggaggaacacatgagtgcagtcatcaaactgcaacttcaagcaga agaaagaggagtggtgtcaatcaagggtgtgagtgcaaatcgctttctggctatgaagga ggatggcagattgctggctttgaaatgtgcaacagaagaatgtttcttttttgagcgttt ggaatctaataactataacacttaccgatcgcggaaatactccgattggtatgtggcact gaaaagaactggacagtataaacctggaccaaaaacaggacctggacagaaagctatcct ttttcttcccatgtctgctaaaagctga

DBGET integrated database retrieval system