Myotis brandtii (Brandt's bat): 102240563 Help Entry 102240563         CDS       T02920                                  Symbol CD3D Name (RefSeq) CD3d molecule   KO K06450   T-cell surface glycoprotein CD3 delta chain Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04640   Hematopoietic cell lineage myb04658   Th1 and Th2 cell differentiation myb04659   Th17 cell differentiation myb04660   T cell receptor signaling pathway myb05142   Chagas disease myb05162   Measles myb05166   Human T-cell leukemia virus 1 infection myb05169   Epstein-Barr virus infection myb05170   Human immunodeficiency virus 1 infection myb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer myb05340   Primary immunodeficiency Brite KEGG Orthology (KO) [BR:myb00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102240563 (CD3D)    04660 T cell receptor signaling pathway     102240563 (CD3D)    04658 Th1 and Th2 cell differentiation     102240563 (CD3D)    04659 Th17 cell differentiation     102240563 (CD3D)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102240563 (CD3D)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102240563 (CD3D)    05170 Human immunodeficiency virus 1 infection     102240563 (CD3D)    05162 Measles     102240563 (CD3D)    05169 Epstein-Barr virus infection     102240563 (CD3D)   09174 Infectious disease: parasitic    05142 Chagas disease     102240563 (CD3D)   09163 Immune disease    05340 Primary immunodeficiency     102240563 (CD3D)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:myb04090]     102240563 (CD3D) CD molecules [BR:myb04090]  Proteins   102240563 (CD3D) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ig_4 ITAM Ig_5 Motif Other DBs NCBI-GeneID:  102240563 NCBI-ProteinID:  XP_005856855 LinkDB All DBs Position Un AA seq 171 aa AA seqDB search MARSRFLAGLALAALLSHVSPFQKFVEEFEDKVVLNCTGTITRLEGTMGIELQDKQSLDL GRRVLDPRGAYLCNETQNEGTPTYTLQVYYRMCQNCVELDPTTLAGIIVTDVIATLLLAL GVYCFAGHETGRLPRAADTQALLRNDQLYQPLRDRNDAQYSHLGESWPRSR NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcagcaggtttctggctggcctggcgctggccgcccttctctcccacgtgagc cccttccagaaattcgtggaggaatttgaggacaaagtggttttgaattgcaccggcacc atcacccggctagagggaacgatggggatcgagttacaggacaagcaaagtctggacttg ggaagacgcgtcctggacccgcggggagcgtacctgtgcaatgagacgcagaacgaaggc accccaacatacaccctgcaagtatattatcgaatgtgccagaactgcgtggagctggac cccaccaccctggccggcatcatcgtcaccgatgtcatcgccaccctgctccttgctttg ggagtctactgctttgctggacacgagactggaaggctgcccagggctgctgacactcag gctctactgaggaacgaccagctctaccagcccctcagagaccggaacgatgctcagtac agtcaccttggtgagagctggcctcggagcaggtga

DBGET integrated database retrieval system