Myotis brandtii (Brandt's bat): 102243164 Help Entry 102243164         CDS       T02920                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism myb  Myotis brandtii (Brandt's bat) Pathway myb03420   Nucleotide excision repair myb04066   HIF-1 signaling pathway myb04110   Cell cycle myb04114   Oocyte meiosis myb04120   Ubiquitin mediated proteolysis myb04141   Protein processing in endoplasmic reticulum myb04310   Wnt signaling pathway myb04350   TGF-beta signaling pathway myb04710   Circadian rhythm myb05170   Human immunodeficiency virus 1 infection myb05200   Pathways in cancer myb05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:myb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102243164    04120 Ubiquitin mediated proteolysis     102243164   09124 Replication and repair    03420 Nucleotide excision repair     102243164  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102243164    04350 TGF-beta signaling pathway     102243164    04066 HIF-1 signaling pathway     102243164  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102243164    04114 Oocyte meiosis     102243164  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     102243164  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102243164   09162 Cancer: specific types    05211 Renal cell carcinoma     102243164   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102243164  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:myb04121]     102243164    03400 DNA repair and recombination proteins [BR:myb03400]     102243164 Enzymes [BR:myb01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102243164 Ubiquitin system [BR:myb04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102243164   Multi subunit type E3    SCF complex     Ring finger protein      102243164    Cul2 complex      102243164    Cul3 complex      102243164    Cul4 complex      102243164    Cul7 complex      102243164    Cul8 complex      102243164    Cul9 complex      102243164 DNA repair and recombination proteins [BR:myb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102243164     TCR (transcription coupled repair) factors      Cul4-CSA complex       102243164 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 PHD_NSD zf-RING_UBOX SCIFF Motif Other DBs NCBI-GeneID:  102243164 NCBI-ProteinID:  XP_005865363 UniProt:  S7MI29 LinkDB All DBs Position Un AA seq 108 aa AA seqDB search MAAAKDVDTPSGTNSGAGKKRFEVKSLKAVALWSWDIEVDNCAICRNHVMDLCIECQANP GSATSEECTVAWGACNHAFHLHCISRWLKTRPVCPLDSRDWEFQKYGK NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagctaaggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaagcttgaaagcagtagccctctggtcctgggacattgaggttgat aactgtgccatctgcaggaaccacgtgatggatctttgcatagaatgtcaggcgaacccg ggatccgccacttctgaagagtgcaccgtcgcgtggggagcctgtaatcatgcttttcac ttgcactgcatctctcgctggctcaaaacacggcccgtgtgtccgctggacagcagagac tgggaattccaaaagtacggaaaatag

DBGET integrated database retrieval system