Myotis brandtii (Brandt's bat): 102244768 Help Entry 102244768         CDS       T02920                                  Symbol TP53 Name (RefSeq) tumor protein p53   KO K04451   tumor protein p53 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb01522   Endocrine resistance myb01524   Platinum drug resistance myb04010   MAPK signaling pathway myb04071   Sphingolipid signaling pathway myb04110   Cell cycle myb04115   p53 signaling pathway myb04137   Mitophagy - animal myb04151   PI3K-Akt signaling pathway myb04210   Apoptosis myb04211   Longevity regulating pathway myb04216   Ferroptosis myb04218   Cellular senescence myb04310   Wnt signaling pathway myb04722   Neurotrophin signaling pathway myb04919   Thyroid hormone signaling pathway myb05012   Parkinson disease myb05014   Amyotrophic lateral sclerosis myb05016   Huntington disease myb05160   Hepatitis C myb05161   Hepatitis B myb05162   Measles myb05163   Human cytomegalovirus infection myb05165   Human papillomavirus infection myb05166   Human T-cell leukemia virus 1 infection myb05167   Kaposi sarcoma-associated herpesvirus infection myb05168   Herpes simplex virus 1 infection myb05169   Epstein-Barr virus infection myb05200   Pathways in cancer myb05202   Transcriptional misregulation in cancer myb05203   Viral carcinogenesis myb05205   Proteoglycans in cancer myb05206   MicroRNAs in cancer myb05210   Colorectal cancer myb05212   Pancreatic cancer myb05213   Endometrial cancer myb05214   Glioma myb05215   Prostate cancer myb05216   Thyroid cancer myb05217   Basal cell carcinoma myb05218   Melanoma myb05219   Bladder cancer myb05220   Chronic myeloid leukemia myb05222   Small cell lung cancer myb05223   Non-small cell lung cancer myb05224   Breast cancer myb05225   Hepatocellular carcinoma myb05226   Gastric cancer myb05230   Central carbon metabolism in cancer myb05417   Lipid and atherosclerosis myb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102244768 (TP53)    04310 Wnt signaling pathway     102244768 (TP53)    04071 Sphingolipid signaling pathway     102244768 (TP53)    04151 PI3K-Akt signaling pathway     102244768 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102244768 (TP53)   09143 Cell growth and death    04110 Cell cycle     102244768 (TP53)    04210 Apoptosis     102244768 (TP53)    04216 Ferroptosis     102244768 (TP53)    04115 p53 signaling pathway     102244768 (TP53)    04218 Cellular senescence     102244768 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102244768 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     102244768 (TP53)   09149 Aging    04211 Longevity regulating pathway     102244768 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102244768 (TP53)    05202 Transcriptional misregulation in cancer     102244768 (TP53)    05206 MicroRNAs in cancer     102244768 (TP53)    05205 Proteoglycans in cancer     102244768 (TP53)    05203 Viral carcinogenesis     102244768 (TP53)    05230 Central carbon metabolism in cancer     102244768 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     102244768 (TP53)    05212 Pancreatic cancer     102244768 (TP53)    05225 Hepatocellular carcinoma     102244768 (TP53)    05226 Gastric cancer     102244768 (TP53)    05214 Glioma     102244768 (TP53)    05216 Thyroid cancer     102244768 (TP53)    05220 Chronic myeloid leukemia     102244768 (TP53)    05217 Basal cell carcinoma     102244768 (TP53)    05218 Melanoma     102244768 (TP53)    05219 Bladder cancer     102244768 (TP53)    05215 Prostate cancer     102244768 (TP53)    05213 Endometrial cancer     102244768 (TP53)    05224 Breast cancer     102244768 (TP53)    05222 Small cell lung cancer     102244768 (TP53)    05223 Non-small cell lung cancer     102244768 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102244768 (TP53)    05161 Hepatitis B     102244768 (TP53)    05160 Hepatitis C     102244768 (TP53)    05162 Measles     102244768 (TP53)    05168 Herpes simplex virus 1 infection     102244768 (TP53)    05163 Human cytomegalovirus infection     102244768 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     102244768 (TP53)    05169 Epstein-Barr virus infection     102244768 (TP53)    05165 Human papillomavirus infection     102244768 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     102244768 (TP53)    05014 Amyotrophic lateral sclerosis     102244768 (TP53)    05016 Huntington disease     102244768 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102244768 (TP53)    05418 Fluid shear stress and atherosclerosis     102244768 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102244768 (TP53)    01522 Endocrine resistance     102244768 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:myb03000]     102244768 (TP53)    03036 Chromosome and associated proteins [BR:myb03036]     102244768 (TP53)    03400 DNA repair and recombination proteins [BR:myb03400]     102244768 (TP53) Transcription factors [BR:myb03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     102244768 (TP53) Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      102244768 (TP53) DNA repair and recombination proteins [BR:myb03400]  Eukaryotic type   Check point factors    Other check point factors     102244768 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  102244768 NCBI-ProteinID:  XP_005878825 LinkDB All DBs Position Un AA seq 390 aa AA seqDB search MDDQQPEVMDPPLSQETFSDLWNLLHDNDLNPEDSQAVGGLGCMPFDLEDCLANGPNEAS SMAATPAPAAAVPAPATPWTLSSSVPSPKTYPGSYGFRLEFLKSGTAKSVTCTYSPILNK LFCQMAKTCPVQLWVNSPPPLSSRVRAMAIYKKSEHMTEVVRRCPHHERCSDYSDGLAPP HHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYATIHYNFMCNSSCMGGMNRRPI LTIITLEDSNGNLLGRNSFEVRICACPGRDRRTEEENFRKKGEPSPKQPPGSPKQPPGST KRALPTNTDPSPPPKKPADEEYFTLQIRGRERFETFRKLNEALELQDDVLAGKDPGGSKS HSSHLKPKKGQPTFRHKKKLMFKREGPDSD NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt atggatgaccaacagccagaagtcatggacccccctctgagtcaggagacattttcagac ttgtggaatttacttcatgacaatgatctgaatcctgaggactcccaggcagtgggtgga ctgggctgcatgcccttcgacctcgaagactgtctggccaacggtccaaatgaagcctcc agtatggcagcaactcctgcaccagcagctgctgtcccagcaccagccaccccctggacc ctgtcatcctctgtcccttccccgaagacctatcctggtagctatggcttccgtttagaa ttcctgaaatctgggacagccaagtctgtaacctgcacgtactcccctatcctcaacaag ctgttttgccagatggcaaagacctgcccggtgcagctgtgggtcaactccccacccccg ctcagctcccgggtccgtgccatggccatctacaagaagtccgagcacatgacggaggtc gtgcggcgctgcccccaccatgagcgctgctctgactatagtgatggtctggctcctcct catcaccttatccgggtggaagggaatctgcgtgccgagtatttggatgacccaaacact ttccgacatagtgtggtggtgccctatgagccgcctgaggtgggctccgactacgccacc attcactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcggcccatc ctcaccatcatcacactggaagattccaatggtaatctgctgggacgaaacagctttgag gtgcgtatttgtgcctgtcctgggagagaccggcgcacagaggaagaaaatttccgtaag aagggggagccaagtcccaagcagccccctgggagtcccaagcagccccctgggagcact aagcgagcactgcccaccaacactgacccctctcctccgccaaagaagccagcggatgaa gaatatttcacccttcagatccgtgggcgtgaacgctttgagacgttccggaaactgaat gaagccttagagctacaggacgatgtcctggctggaaaggacccgggtggaagcaagtct cactccagccacctgaaacctaaaaaggggcagcctaccttccgccataaaaaaaaactc atgttcaagagagagggccctgactccgactga

DBGET integrated database retrieval system