Myotis brandtii (Brandt's bat): 102246008 Help Entry 102246008         CDS       T02920                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb01521   EGFR tyrosine kinase inhibitor resistance myb04010   MAPK signaling pathway myb04014   Ras signaling pathway myb04015   Rap1 signaling pathway myb04020   Calcium signaling pathway myb04151   PI3K-Akt signaling pathway myb04550   Signaling pathways regulating pluripotency of stem cells myb04810   Regulation of actin cytoskeleton myb05167   Kaposi sarcoma-associated herpesvirus infection myb05200   Pathways in cancer myb05205   Proteoglycans in cancer myb05207   Chemical carcinogenesis - receptor activation myb05218   Melanoma myb05224   Breast cancer myb05226   Gastric cancer Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102246008 (FGF2)    04014 Ras signaling pathway     102246008 (FGF2)    04015 Rap1 signaling pathway     102246008 (FGF2)    04020 Calcium signaling pathway     102246008 (FGF2)    04151 PI3K-Akt signaling pathway     102246008 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102246008 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102246008 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102246008 (FGF2)    05205 Proteoglycans in cancer     102246008 (FGF2)    05207 Chemical carcinogenesis - receptor activation     102246008 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     102246008 (FGF2)    05218 Melanoma     102246008 (FGF2)    05224 Breast cancer     102246008 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102246008 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102246008 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myb04052]     102246008 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:myb00536]     102246008 (FGF2) Cytokines and neuropeptides [BR:myb04052]  Cytokines   Growth factors (RTK binding)    102246008 (FGF2) Glycosaminoglycan binding proteins [BR:myb00536]  Heparan sulfate / Heparin   Growth factors/receptors    102246008 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  102246008 NCBI-ProteinID:  XP_014394515 UniProt:  S7MS35 LinkDB All DBs Position Un AA seq 147 aa AA seqDB search MPSLPDDGGSGAFPPGHFKDPKRLYCKNGGFFLRIQPDGRVDGVREKSDPHIKLQLQAEE RGVVSIKGVCANRYLAMKEDGRLQASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALK RNGQYKLGPKTGPGQKAILFLPMSAKS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgccctccctgccggacgacggcggcagcggcgctttcccgcccggccacttcaaggac cccaagcggctgtactgcaaaaacgggggcttcttcttgcgcatccaacccgacggccgc gtggacggggtccgggagaagagcgacccacacatcaaactacaacttcaagcagaagag agaggggtcgtgtctatcaaaggagtgtgtgccaaccgctatctcgctatgaaggaggac ggccggttacaggcttctaaatgtgttacggatgagtgtttcttttttgaacggttggaa tccaataactacaacacttaccggtcaagaaagtactccagttggtatgtggcattgaag cggaatgggcagtataaacttggacccaaaacaggacctggccagaaagccatacttttt cttcccatgtctgctaagagctga

DBGET integrated database retrieval system