Myotis brandtii (Brandt's bat): 102251030 Help Entry 102251030         CDS       T02920                                  Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb03082   ATP-dependent chromatin remodeling myb04015   Rap1 signaling pathway myb04145   Phagosome myb04210   Apoptosis myb04390   Hippo signaling pathway myb04510   Focal adhesion myb04517   IgSF CAM signaling myb04520   Adherens junction myb04530   Tight junction myb04611   Platelet activation myb04613   Neutrophil extracellular trap formation myb04670   Leukocyte transendothelial migration myb04714   Thermogenesis myb04810   Regulation of actin cytoskeleton myb04814   Motor proteins myb04820   Cytoskeleton in muscle cells myb04919   Thyroid hormone signaling pathway myb04921   Oxytocin signaling pathway myb04971   Gastric acid secretion myb05014   Amyotrophic lateral sclerosis myb05100   Bacterial invasion of epithelial cells myb05132   Salmonella infection myb05135   Yersinia infection myb05164   Influenza A myb05205   Proteoglycans in cancer myb05225   Hepatocellular carcinoma myb05410   Hypertrophic cardiomyopathy myb05412   Arrhythmogenic right ventricular cardiomyopathy myb05414   Dilated cardiomyopathy myb05416   Viral myocarditis myb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:myb00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102251030  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102251030    04390 Hippo signaling pathway     102251030   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102251030  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102251030   09143 Cell growth and death    04210 Apoptosis     102251030   09144 Cellular community - eukaryotes    04510 Focal adhesion     102251030    04520 Adherens junction     102251030    04530 Tight junction     102251030   09142 Cell motility    04814 Motor proteins     102251030    04820 Cytoskeleton in muscle cells     102251030    04810 Regulation of actin cytoskeleton     102251030  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102251030    04613 Neutrophil extracellular trap formation     102251030    04670 Leukocyte transendothelial migration     102251030   09152 Endocrine system    04921 Oxytocin signaling pathway     102251030    04919 Thyroid hormone signaling pathway     102251030   09154 Digestive system    04971 Gastric acid secretion     102251030   09159 Environmental adaptation    04714 Thermogenesis     102251030  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102251030   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102251030   09172 Infectious disease: viral    05164 Influenza A     102251030   09171 Infectious disease: bacterial    05132 Salmonella infection     102251030    05135 Yersinia infection     102251030    05100 Bacterial invasion of epithelial cells     102251030   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102251030   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102251030    05410 Hypertrophic cardiomyopathy     102251030    05412 Arrhythmogenic right ventricular cardiomyopathy     102251030    05414 Dilated cardiomyopathy     102251030    05416 Viral myocarditis     102251030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:myb03021]     102251030    03019 Messenger RNA biogenesis [BR:myb03019]     102251030    03036 Chromosome and associated proteins [BR:myb03036]     102251030    03029 Mitochondrial biogenesis [BR:myb03029]     102251030   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myb04812]     102251030    04147 Exosome [BR:myb04147]     102251030 Transcription machinery [BR:myb03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      102251030 Messenger RNA biogenesis [BR:myb03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102251030 Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      102251030     NuA4 complex      102251030   Chromatin remodeling factors    BAF complex     102251030    PBAF complex     102251030    GBAF(ncBAF) complex     102251030    SWR1 complex     102251030 Mitochondrial biogenesis [BR:myb03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     102251030 Cytoskeleton proteins [BR:myb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      102251030 Exosome [BR:myb04147]  Exosomal proteins   Proteins found in most exosomes    102251030 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin DUF6581 Motif Other DBs NCBI-GeneID:  102251030 NCBI-ProteinID:  XP_005870268 LinkDB All DBs Position Un AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQVVMVGMGQKDSYVGDEAQS KRGILTLKYPFEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEISVLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgacgatattgctgcgctagtggtcgacaacggctccggcatgtgcaaagccggc ttcgccggggacgatgcccccagggccgtcttcccctccatcgtggggcgcccccggcac caggttgtgatggtgggcatgggccagaaggactcctacgtgggtgatgaggcccagagc aagagaggcatcctgaccctgaagtacccctttgagcacggcatcgtcaccaactgggac gacatggagaagatctggcatcacactttctacaacgagctgcgtgtggcccccgaggag caccctgtcctgctcaccgaggcccctctgaaccctaaggccaaccgtgagaagatgacc cagatcatgttcgagaccttcaacacccccgccatgtacgtggccatccaggccgtgctg tccctatacgcctctggccgtaccactggcatcgtgatggactccggagacggggtcacc cacacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg gctggccgggacctgaccgactacctcatgaagatcctcaccgagcgtggctacagcttc accaccacggccgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctacgtcgcc ctggacttcgagcaggagatggccaccgcagcctccagctcctccctggagaagagctac gagctgcccgacgggcaggtcatcaccatcggcaatgagcgcttccgctgccccgaggcc ctcttccagccctccttcctgggtatggaatcctgtggcatccatgaaactacctttaac tccatcatgaagtgtgacgtcgacatccgtaaggacctgtacgccaacacggtgctgtct ggtggaaccaccatgtacccaggcatcgccgacaggatgcagaaggagatctctgttttg gctcccagcacgatgaagatcaagatcatcgcgccccctgagcgcaagtactctgtgtgg atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system