Myotis brandtii (Brandt's bat): 102254877 Help Entry 102254877         CDS       T02920                                  Symbol CASP9 Name (RefSeq) caspase 9   KO K04399   caspase 9 [EC:3.4.22.62] Organism myb  Myotis brandtii (Brandt's bat) Pathway myb01524   Platinum drug resistance myb04115   p53 signaling pathway myb04151   PI3K-Akt signaling pathway myb04210   Apoptosis myb04215   Apoptosis - multiple species myb04370   VEGF signaling pathway myb04919   Thyroid hormone signaling pathway myb05010   Alzheimer disease myb05012   Parkinson disease myb05014   Amyotrophic lateral sclerosis myb05016   Huntington disease myb05020   Prion disease myb05022   Pathways of neurodegeneration - multiple diseases myb05134   Legionellosis myb05145   Toxoplasmosis myb05152   Tuberculosis myb05160   Hepatitis C myb05161   Hepatitis B myb05162   Measles myb05163   Human cytomegalovirus infection myb05164   Influenza A myb05167   Kaposi sarcoma-associated herpesvirus infection myb05168   Herpes simplex virus 1 infection myb05169   Epstein-Barr virus infection myb05170   Human immunodeficiency virus 1 infection myb05200   Pathways in cancer myb05210   Colorectal cancer myb05212   Pancreatic cancer myb05213   Endometrial cancer myb05215   Prostate cancer myb05222   Small cell lung cancer myb05223   Non-small cell lung cancer myb05416   Viral myocarditis myb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04370 VEGF signaling pathway     102254877 (CASP9)    04151 PI3K-Akt signaling pathway     102254877 (CASP9)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102254877 (CASP9)    04215 Apoptosis - multiple species     102254877 (CASP9)    04115 p53 signaling pathway     102254877 (CASP9)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102254877 (CASP9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102254877 (CASP9)   09162 Cancer: specific types    05210 Colorectal cancer     102254877 (CASP9)    05212 Pancreatic cancer     102254877 (CASP9)    05215 Prostate cancer     102254877 (CASP9)    05213 Endometrial cancer     102254877 (CASP9)    05222 Small cell lung cancer     102254877 (CASP9)    05223 Non-small cell lung cancer     102254877 (CASP9)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102254877 (CASP9)    05161 Hepatitis B     102254877 (CASP9)    05160 Hepatitis C     102254877 (CASP9)    05164 Influenza A     102254877 (CASP9)    05162 Measles     102254877 (CASP9)    05168 Herpes simplex virus 1 infection     102254877 (CASP9)    05163 Human cytomegalovirus infection     102254877 (CASP9)    05167 Kaposi sarcoma-associated herpesvirus infection     102254877 (CASP9)    05169 Epstein-Barr virus infection     102254877 (CASP9)   09171 Infectious disease: bacterial    05134 Legionellosis     102254877 (CASP9)    05152 Tuberculosis     102254877 (CASP9)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102254877 (CASP9)   09164 Neurodegenerative disease    05010 Alzheimer disease     102254877 (CASP9)    05012 Parkinson disease     102254877 (CASP9)    05014 Amyotrophic lateral sclerosis     102254877 (CASP9)    05016 Huntington disease     102254877 (CASP9)    05020 Prion disease     102254877 (CASP9)    05022 Pathways of neurodegeneration - multiple diseases     102254877 (CASP9)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102254877 (CASP9)    05416 Viral myocarditis     102254877 (CASP9)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102254877 (CASP9)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:myb01009]     102254877 (CASP9)    01002 Peptidases and inhibitors [BR:myb01002]     102254877 (CASP9) Enzymes [BR:myb01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.62  caspase-9      102254877 (CASP9) Protein phosphatases and associated proteins [BR:myb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102254877 (CASP9) Peptidases and inhibitors [BR:myb01002]  Cysteine peptidases   Family C14: caspase family    102254877 (CASP9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 CARD Motif Other DBs NCBI-GeneID:  102254877 NCBI-ProteinID:  XP_014388774 LinkDB All DBs Position Un AA seq 413 aa AA seqDB search MNGLMQRHVFLSKQRAGSGSRRDQARQLVIDLETRGSQALPLFISCLEDTGQQSLASLLR ASSQAARRNPEAIRPLDLRPVVVRPEELRVVKQDPSKLTPGRLTPVALGPEELYPEVPRP GVPRPVDIGAGGYSDIRAHGRRRGSADLAYALNADPCGHCLIINNVNFCLKSGLSTRKGS HVDCEKLQRCFRLLHFAVEVESDLTAKEMVQALMELARRDHRALDCCVVVILSHGCQASH LQFPGAVYGTDGCPVPVERIVNIFNGTGCPSLGGKPKLFFIQACGGGQKDHGFEVVSASP EDRALDGNPEPDAFPFQDHPGRYDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTNNGSWY IETLVGVLEQWAHSEDLQSLLLRVANAVSEKGIYKQIPGCFNFLRKKLFFKTS NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt atgaacggccttatgcagcgccatgtgtttctttccaaacagagggccggctctgggtct cggcgcgatcaggccaggcagctggtcatagatctggagactcgagggagtcaggccctt cctctgttcatctcctgcttggaggacacaggccagcagagcctggcttcactgctgaga gcgagtagccaagcagcaaggcggaatccggaagccatcagacccctggacctcaggcct gtggtggtcagaccagaggagctaagagtagtgaagcaggatccgtcgaagctgacccca ggcagactcactccagtggcgttggggccagaggagctctatccagaggttcccagacca ggggtgccccggccagtggacattggtgctggaggatacagtgatatccgtgctcacggg cgacggaggggaagcgctgatttggcgtacgccctgaacgcggacccttgtggccactgc ctcattatcaacaacgtgaacttctgccttaagtcggggctcagcacccgcaagggctcc cacgtggactgcgagaagctgcaaagatgcttccgcttgctgcacttcgcggtggaggtg gagagcgacctgactgccaaggaaatggtccaggctctgatggagctggcgcggcgggac cacagggccctggactgctgcgtggtggtcatcctgtctcacggctgccaggccagccac ctccagttcccgggggctgtttatggcacagatgggtgtcctgtgcctgtggagagaatc gtgaacatcttcaacgggaccggctgccccagcctgggagggaagcccaagctgtttttc atccaggcctgcgggggagggcagaaagaccatgggtttgaggtggtctccgcttcccct gaggacagggcccttgacggtaacccggagccagacgccttcccgttccaggaccacccc ggccgctacgaccagccggacgccgtgtctagtttgcccacaccgagtgacatcttcgtg tcttactccaccttcccaggttttgtctcctggagggataccaacaacggctcctggtac atcgagaccctggttggcgttttggagcagtgggctcactcggaagacctgcagagcctc ctgctccgggtcgctaatgctgtttcggagaaaggcatttacaaacagattcctgggtgt tttaatttcctccggaaaaaactcttctttaaaacttcatga

DBGET integrated database retrieval system