Myotis brandtii (Brandt's bat): 102257541 Help Entry 102257541         CDS       T02920                                  Symbol HYPK Name (RefSeq) huntingtin interacting protein K   KO K28128   huntingtin-interacting protein K Organism myb  Myotis brandtii (Brandt's bat) Brite KEGG Orthology (KO) [BR:myb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:myb03110]     102257541 (HYPK)    03036 Chromosome and associated proteins [BR:myb03036]     102257541 (HYPK) Chaperones and folding catalysts [BR:myb03110]  Other chaperones and cochaperones   Others    102257541 (HYPK) Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Sister chromatid cohesion proteins    Other sister chromatid cohesion factors     102257541 (HYPK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  UBA_HYPK UBA_7 SPT6_acidic Motif Other DBs NCBI-GeneID:  102257541 NCBI-ProteinID:  XP_005877601 UniProt:  S7NCG0 LinkDB All DBs Position Un AA seq 121 aa AA seqDB search MATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIG DRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALT N NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgagggggatgtggagctggaattggagaccgagaccagcggcccggagcgg ccccccgagaagccacggaagcatgacagtggtgcggcggacctggagagagtgaccgac tatgcggaggagaaggagatccagagttccaacctggagacggccatgtccgtgattgga gacagacgttcccgggagcagaaagccaaacaagagcgggagaaggaactggcaaaagtc accatcaagaaggaagatctggagctgataatgacagagatggagatctcaagagcagcc gcagagcggagcttgagggaacacatgggcaacgtggtagaggctcttattgccctaacc aactga

DBGET integrated database retrieval system