Myotis brandtii (Brandt's bat): 102261527 Help Entry 102261527         CDS       T02920                                  Symbol CDK4 Name (RefSeq) cyclin dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism myb  Myotis brandtii (Brandt's bat) Pathway myb01522   Endocrine resistance myb04110   Cell cycle myb04115   p53 signaling pathway myb04151   PI3K-Akt signaling pathway myb04218   Cellular senescence myb04530   Tight junction myb04660   T cell receptor signaling pathway myb04933   AGE-RAGE signaling pathway in diabetic complications myb04934   Cushing syndrome myb05160   Hepatitis C myb05162   Measles myb05163   Human cytomegalovirus infection myb05164   Influenza A myb05165   Human papillomavirus infection myb05166   Human T-cell leukemia virus 1 infection myb05167   Kaposi sarcoma-associated herpesvirus infection myb05169   Epstein-Barr virus infection myb05200   Pathways in cancer myb05203   Viral carcinogenesis myb05212   Pancreatic cancer myb05214   Glioma myb05218   Melanoma myb05219   Bladder cancer myb05220   Chronic myeloid leukemia myb05222   Small cell lung cancer myb05223   Non-small cell lung cancer myb05224   Breast cancer myb05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     102261527 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102261527 (CDK4)    04115 p53 signaling pathway     102261527 (CDK4)    04218 Cellular senescence     102261527 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     102261527 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102261527 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102261527 (CDK4)    05203 Viral carcinogenesis     102261527 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     102261527 (CDK4)    05225 Hepatocellular carcinoma     102261527 (CDK4)    05214 Glioma     102261527 (CDK4)    05220 Chronic myeloid leukemia     102261527 (CDK4)    05218 Melanoma     102261527 (CDK4)    05219 Bladder cancer     102261527 (CDK4)    05224 Breast cancer     102261527 (CDK4)    05222 Small cell lung cancer     102261527 (CDK4)    05223 Non-small cell lung cancer     102261527 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102261527 (CDK4)    05160 Hepatitis C     102261527 (CDK4)    05164 Influenza A     102261527 (CDK4)    05162 Measles     102261527 (CDK4)    05163 Human cytomegalovirus infection     102261527 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     102261527 (CDK4)    05169 Epstein-Barr virus infection     102261527 (CDK4)    05165 Human papillomavirus infection     102261527 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102261527 (CDK4)    04934 Cushing syndrome     102261527 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102261527 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:myb01001]     102261527 (CDK4) Enzymes [BR:myb01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      102261527 (CDK4) Protein kinases [BR:myb01001]  Serine/threonine kinases: CMGC group   CDK family    102261527 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  102261527 NCBI-ProteinID:  XP_005879109 LinkDB All DBs Position Un AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRMYLDKAPPPGLPVETIKDL MRQLLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPR DVSLPRGAFPPRGPCPVQSVIPEMEKSGAQLLLEMLTFNPHKRISAFRALQHSYLQKEEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacccctcgatatgagcccgtggctgagattggtgttggtgcctacgggacggtg tacaaggcccgtgatccgcacagtggccacttcgtggccctcaagagcgtgagagtcccc aatggaggaggggccggagggggccttcccgtcagcacagtccgtgaggtggccttactg cggcggctggaggcttttgagcaccccaatgttgtccggctgatggatgtctgtgccacc gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta cggatgtatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg atgcggcagcttctgagaggcctggattttctgcatgccaattgcattgttcaccgagac ctgaagccagagaatattctggtgacaagcagtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtac cgtgctccggaagttcttctgcagtctacatacgcaactcctgtggacttgtggagcgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgcggaaactctgaagct gaccaattgggcaaaatctttgacctgattgggctgcctccagaggaagactggccccga gatgtgtctctaccccgaggagccttcccccccagagggccctgcccagtgcagtcggtg atcccggagatggagaagtctggagcacagctgctgctggagatgctgacgtttaaccca cacaagcgaatctctgccttccgagccctgcagcactcctatctacaaaaggaagaaggt aacccagagtga

DBGET integrated database retrieval system