Myotis brandtii (Brandt's bat): 102261582 Help Entry 102261582         CDS       T02920                                  Symbol RHOG Name (RefSeq) ras homolog family member G   KO K07863   Ras homolog gene family, member G Organism myb  Myotis brandtii (Brandt's bat) Pathway myb05100   Bacterial invasion of epithelial cells myb05132   Salmonella infection myb05135   Yersinia infection Brite KEGG Orthology (KO) [BR:myb00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102261582 (RHOG)    05135 Yersinia infection     102261582 (RHOG)    05100 Bacterial invasion of epithelial cells     102261582 (RHOG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102261582 (RHOG)    04031 GTP-binding proteins [BR:myb04031]     102261582 (RHOG) Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102261582 (RHOG)   Exosomal proteins of other body fluids (saliva and urine)    102261582 (RHOG)   Exosomal proteins of colorectal cancer cells    102261582 (RHOG)   Exosomal proteins of bladder cancer cells    102261582 (RHOG) GTP-binding proteins [BR:myb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     102261582 (RHOG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  102261582 NCBI-ProteinID:  XP_005867204 UniProt:  S7MXY0 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT PVKRGRSCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagagcataaagtgtgtggtggtgggcgacggggctgtgggcaagacatgcctgctc atctgctacacaactaatgccttccccaaggaatacatccccacagtgttcgacaattac agcgcccagagcgcagttgatgggcgcacagtgaacctgaacctgtgggacacagcgggc caggaggagtacgaccgcctccgcactctctcctaccctcagaccaacgtctttgtcatc tgtttctccattgccagtccaccctcttatgagaatgtgcggcacaagtggcatccggag gtgtgccaccactgccctgatgtgcccatcctcctggtgggcaccaagaaggacctgaga gcccagcctgacaccctgcggcgcctcaaggagcagggccaggcgcccatcacaccgcag caaggccaggcactggccaagcagatccatgctgtgcgctacctcgagtgctcagccctg cagcaggatggcgtcaaggaagtgttcgctgaggctgtccgggctgtgctcaaccccaca ccggtcaagcgtgggcggtcctgtgtcctcttgtga

DBGET integrated database retrieval system