Myotis davidii (David's myotis): 102759012 Help Entry 102759012         CDS       T02992                                  Symbol TP53 Name (RefSeq) tumor protein p53   KO K04451   tumor protein p53 Organism myd  Myotis davidii (David's myotis) Pathway myd01522   Endocrine resistance myd01524   Platinum drug resistance myd04010   MAPK signaling pathway myd04071   Sphingolipid signaling pathway myd04110   Cell cycle myd04115   p53 signaling pathway myd04137   Mitophagy - animal myd04151   PI3K-Akt signaling pathway myd04210   Apoptosis myd04211   Longevity regulating pathway myd04216   Ferroptosis myd04218   Cellular senescence myd04310   Wnt signaling pathway myd04722   Neurotrophin signaling pathway myd04919   Thyroid hormone signaling pathway myd05012   Parkinson disease myd05014   Amyotrophic lateral sclerosis myd05016   Huntington disease myd05160   Hepatitis C myd05161   Hepatitis B myd05162   Measles myd05163   Human cytomegalovirus infection myd05165   Human papillomavirus infection myd05166   Human T-cell leukemia virus 1 infection myd05167   Kaposi sarcoma-associated herpesvirus infection myd05168   Herpes simplex virus 1 infection myd05169   Epstein-Barr virus infection myd05200   Pathways in cancer myd05202   Transcriptional misregulation in cancer myd05203   Viral carcinogenesis myd05205   Proteoglycans in cancer myd05206   MicroRNAs in cancer myd05210   Colorectal cancer myd05212   Pancreatic cancer myd05213   Endometrial cancer myd05214   Glioma myd05215   Prostate cancer myd05216   Thyroid cancer myd05217   Basal cell carcinoma myd05218   Melanoma myd05219   Bladder cancer myd05220   Chronic myeloid leukemia myd05222   Small cell lung cancer myd05223   Non-small cell lung cancer myd05224   Breast cancer myd05225   Hepatocellular carcinoma myd05226   Gastric cancer myd05230   Central carbon metabolism in cancer myd05417   Lipid and atherosclerosis myd05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102759012 (TP53)    04310 Wnt signaling pathway     102759012 (TP53)    04071 Sphingolipid signaling pathway     102759012 (TP53)    04151 PI3K-Akt signaling pathway     102759012 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102759012 (TP53)   09143 Cell growth and death    04110 Cell cycle     102759012 (TP53)    04210 Apoptosis     102759012 (TP53)    04216 Ferroptosis     102759012 (TP53)    04115 p53 signaling pathway     102759012 (TP53)    04218 Cellular senescence     102759012 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102759012 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     102759012 (TP53)   09149 Aging    04211 Longevity regulating pathway     102759012 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102759012 (TP53)    05202 Transcriptional misregulation in cancer     102759012 (TP53)    05206 MicroRNAs in cancer     102759012 (TP53)    05205 Proteoglycans in cancer     102759012 (TP53)    05203 Viral carcinogenesis     102759012 (TP53)    05230 Central carbon metabolism in cancer     102759012 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     102759012 (TP53)    05212 Pancreatic cancer     102759012 (TP53)    05225 Hepatocellular carcinoma     102759012 (TP53)    05226 Gastric cancer     102759012 (TP53)    05214 Glioma     102759012 (TP53)    05216 Thyroid cancer     102759012 (TP53)    05220 Chronic myeloid leukemia     102759012 (TP53)    05217 Basal cell carcinoma     102759012 (TP53)    05218 Melanoma     102759012 (TP53)    05219 Bladder cancer     102759012 (TP53)    05215 Prostate cancer     102759012 (TP53)    05213 Endometrial cancer     102759012 (TP53)    05224 Breast cancer     102759012 (TP53)    05222 Small cell lung cancer     102759012 (TP53)    05223 Non-small cell lung cancer     102759012 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102759012 (TP53)    05161 Hepatitis B     102759012 (TP53)    05160 Hepatitis C     102759012 (TP53)    05162 Measles     102759012 (TP53)    05168 Herpes simplex virus 1 infection     102759012 (TP53)    05163 Human cytomegalovirus infection     102759012 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     102759012 (TP53)    05169 Epstein-Barr virus infection     102759012 (TP53)    05165 Human papillomavirus infection     102759012 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     102759012 (TP53)    05014 Amyotrophic lateral sclerosis     102759012 (TP53)    05016 Huntington disease     102759012 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102759012 (TP53)    05418 Fluid shear stress and atherosclerosis     102759012 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102759012 (TP53)    01522 Endocrine resistance     102759012 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:myd03000]     102759012 (TP53)    03036 Chromosome and associated proteins [BR:myd03036]     102759012 (TP53)    03400 DNA repair and recombination proteins [BR:myd03400]     102759012 (TP53) Transcription factors [BR:myd03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     102759012 (TP53) Chromosome and associated proteins [BR:myd03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      102759012 (TP53) DNA repair and recombination proteins [BR:myd03400]  Eukaryotic type   Check point factors    Other check point factors     102759012 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD CEP1-DNA_bind Pvc16_N Motif Other DBs NCBI-GeneID:  102759012 NCBI-ProteinID:  XP_006761715 LinkDB All DBs Position Un AA seq 425 aa AA seqDB search MDENRDGSDASTSQGTPRIVGDRQQLEESHAAFQGAAMDDQQLEVVDPPLSQETFSDLWN SLHGNNDLDSQAVGGLDWMPFSLEDCLDNGPNEASSMATTPAPAAAVPAPATSCTLSSSV PSPKTYPGSYGFRLDFLKSGTAKSVTCTYSPVLNKLFCQMAKSCPVQLWVSSPPPLHSRV RAMAIYKKSEHMTEVVRRCPHHERCSEYSDGLAPPHHLIRVEGNLRAEYLDDMNTFRHSV VVPYEPPEVGSEYATIHYNFMCNSSCMGGMNRRPILTIITLEDSNGNLLGRNSFEVRICA CPGRDRRTEEENFRKKGEPSPKQPPGSPKQPPGSTKRALPTNTDSSPPPKKPADEEYFTL QIRGRERFETFRKLNEALELQDDVLAGKDPGGSKTHSSHLKPKKGQSTSRHKKRLMFKRE GPDSD NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt atggatgaaaacagagatgggagtgatgcatctacaagtcaaggaacaccaaggattgtc ggagaccgccagcaattagaagagagccacgctgccttccagggagctgcaatggatgac caacagttagaagtcgtggacccccctctgagtcaggagacattttcagacttgtggaat tcacttcacggaaacaatgatctggactcccaggcagtgggtggactggactggatgccc ttcagcctcgaagactgtctggacaacggcccaaatgaagcctccagcatggcaacaact cctgcaccagcagctgctgtcccagcaccagccacctcctgcaccctgtcatcctctgtc ccttccccgaagacctatcctggtagctatggcttccgtttagacttcctgaaatctggg acagccaagtctgtaacctgcacgtactcccccgtcctcaacaagctgttttgccagatg gcaaagtcctgcccggtgcagctgtgggtcagctccccacccccgctccattcccgggtc cgtgccatggccatctacaagaagtccgagcacatgacggaggtcgtgcggcgctgcccc caccatgagcgctgctccgagtacagtgacggtctggctcctcctcatcaccttatccgg gtggaagggaatttgcgtgctgagtatttggatgacatgaacactttccgacatagtgtg gtggtgccctacgagccgcctgaggtgggctccgagtacgccaccattcactacaacttc atgtgtaacagctcctgcatggggggcatgaaccggcggcccatcctcaccatcatcaca ctggaagattccaatggtaatctgctgggacgaaacagctttgaggtgcgtatttgtgcc tgtcctgggagagaccggcgcacagaggaagaaaatttccgcaagaagggggagccgagt cccaagcagccccctgggagtcccaagcagccccctgggagcactaagcgagcactgccc accaacactgactcctctcctccgccaaagaagccagcggatgaagaatatttcaccctt cagatccgtgggcgtgaacgctttgagacgttccggaaactgaatgaagccttagagcta caggacgatgtcctggctggaaaggacccgggtggaagcaagactcactccagccacctg aaacctaaaaaggggcagtctacctcccgccataaaaaaagactcatgttcaagagagaa ggacctgactccgactga

DBGET integrated database retrieval system