Myotis davidii (David's myotis): 102765800 Help Entry 102765800         CDS       T02992                                  Symbol IFNB1 Name (RefSeq) interferon beta 1   KO K05415   interferon beta Organism myd  Myotis davidii (David's myotis) Pathway myd04060   Cytokine-cytokine receptor interaction myd04151   PI3K-Akt signaling pathway myd04217   Necroptosis myd04380   Osteoclast differentiation myd04620   Toll-like receptor signaling pathway myd04621   NOD-like receptor signaling pathway myd04622   RIG-I-like receptor signaling pathway myd04623   Cytosolic DNA-sensing pathway myd04630   JAK-STAT signaling pathway myd04650   Natural killer cell mediated cytotoxicity myd04668   TNF signaling pathway myd04936   Alcoholic liver disease myd05135   Yersinia infection myd05142   Chagas disease myd05152   Tuberculosis myd05160   Hepatitis C myd05161   Hepatitis B myd05162   Measles myd05163   Human cytomegalovirus infection myd05164   Influenza A myd05165   Human papillomavirus infection myd05167   Kaposi sarcoma-associated herpesvirus infection myd05168   Herpes simplex virus 1 infection myd05169   Epstein-Barr virus infection myd05170   Human immunodeficiency virus 1 infection myd05171   Coronavirus disease - COVID-19 myd05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102765800 (IFNB1)    04668 TNF signaling pathway     102765800 (IFNB1)    04151 PI3K-Akt signaling pathway     102765800 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102765800 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102765800 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102765800 (IFNB1)    04621 NOD-like receptor signaling pathway     102765800 (IFNB1)    04622 RIG-I-like receptor signaling pathway     102765800 (IFNB1)    04623 Cytosolic DNA-sensing pathway     102765800 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     102765800 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     102765800 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102765800 (IFNB1)    05161 Hepatitis B     102765800 (IFNB1)    05160 Hepatitis C     102765800 (IFNB1)    05171 Coronavirus disease - COVID-19     102765800 (IFNB1)    05164 Influenza A     102765800 (IFNB1)    05162 Measles     102765800 (IFNB1)    05168 Herpes simplex virus 1 infection     102765800 (IFNB1)    05163 Human cytomegalovirus infection     102765800 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     102765800 (IFNB1)    05169 Epstein-Barr virus infection     102765800 (IFNB1)    05165 Human papillomavirus infection     102765800 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     102765800 (IFNB1)    05152 Tuberculosis     102765800 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     102765800 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102765800 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102765800 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102765800 (IFNB1) Cytokines and neuropeptides [BR:myd04052]  Cytokines   Interferons    102765800 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon KAR9 IL1_propep Motif Other DBs NCBI-GeneID:  102765800 NCBI-ProteinID:  XP_006765009 UniProt:  L5LSB2 LinkDB All DBs Position Un AA seq 186 aa AA seqDB search MTNRCTLQLTVLLCLTGAALSVNYGKLRFKLRSSNSACQTLLWQLITSPQHCLDDRMDFQ IPRQVEQPQQFQKEEAMVVMYEMLQQIHTIFRRSFSNAGWNETIVEKLLEELDDQMDCLE TALEEIKQEGKFPWENRTALRLKTYYLGILQYLKAKFYGRCAWTVVQVEIFRNVSFLNGL IGALQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtgcaccctccagctcaccgtcctgctgtgtctcaccggggccgcgctc tccgtgaactacggcaagctccgcttcaagctgagaagcagcaattcagcctgccagacg ctcctgtggcagttgattacaagccctcagcattgcctggacgacaggatggacttccag atccccagacaggttgaacaaccacagcagttccagaaggaggaagccatggtggtcatg tacgagatgctccagcagatccacaccattttcagaagaagtttctccaacgctggctgg aatgagaccattgttgagaaacttctggaggagctcgatgaccagatggactgcctggag acagccctggaggaaatcaagcaggagggaaagttcccctgggaaaacaggaccgcgctg cgtctgaagacctattacttaggcatcctccagtacctgaaggccaagttctacggcaga tgtgcctggacagtagtccaagtggaaatcttcaggaacgtttccttccttaatggactt ataggtgccctccaggactga

DBGET integrated database retrieval system