Myotis davidii (David's myotis): 102774814 Help Entry 102774814         CDS       T02992                                  Symbol IL10 Name (RefSeq) interleukin 10   KO K05443   interleukin 10 Organism myd  Myotis davidii (David's myotis) Pathway myd04060   Cytokine-cytokine receptor interaction myd04061   Viral protein interaction with cytokine and cytokine receptor myd04068   FoxO signaling pathway myd04148   Efferocytosis myd04625   C-type lectin receptor signaling pathway myd04630   JAK-STAT signaling pathway myd04660   T cell receptor signaling pathway myd04672   Intestinal immune network for IgA production myd05133   Pertussis myd05135   Yersinia infection myd05140   Leishmaniasis myd05142   Chagas disease myd05143   African trypanosomiasis myd05144   Malaria myd05145   Toxoplasmosis myd05146   Amoebiasis myd05150   Staphylococcus aureus infection myd05152   Tuberculosis myd05310   Asthma myd05320   Autoimmune thyroid disease myd05321   Inflammatory bowel disease myd05322   Systemic lupus erythematosus myd05330   Allograft rejection Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102774814 (IL10)    04068 FoxO signaling pathway     102774814 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102774814 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     102774814 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     102774814 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102774814 (IL10)    04660 T cell receptor signaling pathway     102774814 (IL10)    04672 Intestinal immune network for IgA production     102774814 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102774814 (IL10)    05133 Pertussis     102774814 (IL10)    05150 Staphylococcus aureus infection     102774814 (IL10)    05152 Tuberculosis     102774814 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     102774814 (IL10)    05144 Malaria     102774814 (IL10)    05145 Toxoplasmosis     102774814 (IL10)    05140 Leishmaniasis     102774814 (IL10)    05142 Chagas disease     102774814 (IL10)    05143 African trypanosomiasis     102774814 (IL10)   09163 Immune disease    05310 Asthma     102774814 (IL10)    05322 Systemic lupus erythematosus     102774814 (IL10)    05320 Autoimmune thyroid disease     102774814 (IL10)    05321 Inflammatory bowel disease     102774814 (IL10)    05330 Allograft rejection     102774814 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102774814 (IL10)    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102774814 (IL10) Cytokines and neuropeptides [BR:myd04052]  Cytokines   Interleukins    102774814 (IL10) Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Cytokines    102774814 (IL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 Tyr_recomb_halo_N Motif Other DBs NCBI-GeneID:  102774814 NCBI-ProteinID:  XP_006754445 UniProt:  L5MFM7 LinkDB All DBs Position Un AA seq 178 aa AA seqDB search MPSSALLCCLVFLAGMGASPAQGTPSENSCTHFSTSLPHMLRELRAAFNRVKTFFQMKDQ LDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAETQGPDIKEPVNSLGEKLKTLR LQLRRCHRFLPCENKSKAVEQVKSAFNKLQERGVYKAMSEFDIFINYIEAYMTMKMKN NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcccagctcagcactgctctgttgcctggtcttcctggctgggatgggggccagccca gcccagggcacgccatctgagaacagctgcacccacttctccaccagcctgccccacatg cttcgagagctccgagctgccttcaacagggtgaagactttctttcaaatgaaggaccag ctggacaacatgctgttgaacgggtctttgctggaggacttcaagggttacctgggttgc caagccttgtcggagatgatccagttttacctggaagaggtgatgccccaggccgagacc cagggccccgacatcaaggagcccgtgaactcgctgggggagaagctgaagacgctgagg ctgcagctgcggcgctgtcatcgctttctgccctgtgagaataagagcaaagccgtggag caggtgaagagcgccttcaataagctccaggagagaggggtctacaaagccatgagtgag tttgacatcttcatcaactacatagaggcctacatgacaatgaagatgaaaaactga

DBGET integrated database retrieval system