Myotis yumanensis (Yuma myotis): 139006971 Help Entry 139006971         CDS       T10762                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum01522   Endocrine resistance myum04110   Cell cycle myum04115   p53 signaling pathway myum04151   PI3K-Akt signaling pathway myum04218   Cellular senescence myum04530   Tight junction myum04660   T cell receptor signaling pathway myum04933   AGE-RAGE signaling pathway in diabetic complications myum04934   Cushing syndrome myum05160   Hepatitis C myum05162   Measles myum05163   Human cytomegalovirus infection myum05164   Influenza A myum05165   Human papillomavirus infection myum05166   Human T-cell leukemia virus 1 infection myum05167   Kaposi sarcoma-associated herpesvirus infection myum05169   Epstein-Barr virus infection myum05200   Pathways in cancer myum05203   Viral carcinogenesis myum05212   Pancreatic cancer myum05214   Glioma myum05218   Melanoma myum05219   Bladder cancer myum05220   Chronic myeloid leukemia myum05222   Small cell lung cancer myum05223   Non-small cell lung cancer myum05224   Breast cancer myum05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     139006971 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     139006971 (CDK4)    04115 p53 signaling pathway     139006971 (CDK4)    04218 Cellular senescence     139006971 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     139006971 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     139006971 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     139006971 (CDK4)    05203 Viral carcinogenesis     139006971 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     139006971 (CDK4)    05225 Hepatocellular carcinoma     139006971 (CDK4)    05214 Glioma     139006971 (CDK4)    05220 Chronic myeloid leukemia     139006971 (CDK4)    05218 Melanoma     139006971 (CDK4)    05219 Bladder cancer     139006971 (CDK4)    05224 Breast cancer     139006971 (CDK4)    05222 Small cell lung cancer     139006971 (CDK4)    05223 Non-small cell lung cancer     139006971 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     139006971 (CDK4)    05160 Hepatitis C     139006971 (CDK4)    05164 Influenza A     139006971 (CDK4)    05162 Measles     139006971 (CDK4)    05163 Human cytomegalovirus infection     139006971 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     139006971 (CDK4)    05169 Epstein-Barr virus infection     139006971 (CDK4)    05165 Human papillomavirus infection     139006971 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     139006971 (CDK4)    04934 Cushing syndrome     139006971 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     139006971 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:myum01001]     139006971 (CDK4) Enzymes [BR:myum01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      139006971 (CDK4) Protein kinases [BR:myum01001]  Serine/threonine kinases: CMGC group   CDK family    139006971 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  139006971 NCBI-ProteinID:  XP_070265958 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPR DVSLPRGAFPPRGPCPVQSVIPEMEKSGAQLLLEMLTFNPHKRISAFRALQHSYLQKEEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacccctcgatatgagcccgtggctgagattggtgttggtgcctacgggacggtg tacaaggcccgtgatccacacagtggccacttcgtggccctcaagagcgtgagagtcccc aatggaggaggggccggagggggccttcccgtcagcacagtccgtgaggtggccttactg cggcggctggaggcttttgagcaccccaatgttgtccggctgatggatgtctgtgccacc gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcacgtggaccaagaccta cggacgtatctggacaaggcacccccaccaggcctgccagtggagaccatcaaggatctg atgcggcagtttctgagaggcctggattttctgcatgccaattgcattgttcaccgagac ctgaagccagagaatattctggtgacaagcagtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac cgtgctccggaagttcttctgcagtctacatacgcaactcctgtggacttgtggagcgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgcggaaactctgaagct gaccaattgggcaaaatctttgacctgattgggctgcctccagaggaagactggcccaga gatgtgtctctaccccgaggagccttccccccaagagggccctgcccagtgcagtcggtg atcccagagatggagaagtctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcctatctacaaaaggaagaaggt aacccagagtga

DBGET integrated database retrieval system