Myotis yumanensis (Yuma myotis): 139012390 Help Entry 139012390         CDS       T10762                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum03083   Polycomb repressive complex myum04010   MAPK signaling pathway myum05200   Pathways in cancer myum05202   Transcriptional misregulation in cancer myum05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:myum00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     139012390 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     139012390 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     139012390 (MAX)    05202 Transcriptional misregulation in cancer     139012390 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     139012390 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:myum03000]     139012390 (MAX)    03036 Chromosome and associated proteins [BR:myum03036]     139012390 (MAX) Transcription factors [BR:myum03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     139012390 (MAX) Chromosome and associated proteins [BR:myum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      139012390 (MAX) SSDB OrthologParalogGFIT Motif Pfam:  HLH CEP135_TSGA10_CC bHLH_IRO3 bZIP_2 JetA Filament TPR YEL043W_helical bHLH_INO4 T4SS_LegC2C7 SlyX Tp0624_N PUMA_CC bHLH_SAC51 ANG-1 MYCBP_helical SLX9 GAGA_bind DUF7801 DUF4763 Csm1_N Motif Other DBs NCBI-GeneID:  139012390 NCBI-ProteinID:  XP_070274395 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSAISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaagcgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgcccttctggagcagcaagtccgt gcactggagaaagcgaggtcgagtgcccaactgcagaccaactacccttcctcagacaac agcctctacaccaacgccaagggcagcgccatctctgccttcgatgggggctcggactcc agctcagagtcggagcctgaagagccccaaagcaggaagaaactccggatggaggccagc taa

DBGET integrated database retrieval system