Maylandia zebra (zebra mbuna): 101467159 Help Entry 101467159         CDS       T02814                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism mze  Maylandia zebra (zebra mbuna) Pathway mze03008   Ribosome biogenesis in eukaryotes mze03013   Nucleocytoplasmic transport mze03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:mze00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     101467159 (ran)    03008 Ribosome biogenesis in eukaryotes     101467159 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     101467159 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mze03019]     101467159 (ran)    03009 Ribosome biogenesis [BR:mze03009]     101467159 (ran)    03016 Transfer RNA biogenesis [BR:mze03016]     101467159 (ran)    03036 Chromosome and associated proteins [BR:mze03036]     101467159 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mze04147]     101467159 (ran)    04031 GTP-binding proteins [BR:mze04031]     101467159 (ran) Messenger RNA biogenesis [BR:mze03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      101467159 (ran) Ribosome biogenesis [BR:mze03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     101467159 (ran)   Pre-60S particles     101467159 (ran) Transfer RNA biogenesis [BR:mze03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     101467159 (ran) Chromosome and associated proteins [BR:mze03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      101467159 (ran)    Spindle formation proteins     101467159 (ran) Exosome [BR:mze04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101467159 (ran) GTP-binding proteins [BR:mze04031]  Small (monomeric) G-proteins   Ran Family    Ran     101467159 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RNA_helicase AAA_24 ArgoMid Pox_A32 AAA_7 DUF5935 TsaE DUF5906 AAA_16 AAA_22 Motif Other DBs NCBI-GeneID:  101467159 NCBI-ProteinID:  XP_024660729 UniProt:  A0A3P9B3D9 LinkDB All DBs Position LG2:25973599..25975271 Genome browser AA seq 215 aa AA seqDB search MAQCVPVAVFKLVLVGDGGTGKTTFVKRHITGEFEKKYVATLGVEVHPLIFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LAPPEVQMDPSLAAKYEEELQVASQTALPDEEDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcacagtgtgttccggtggcggtgtttaagttggtgttggtaggagatggaggcacc gggaaaacgactttcgtgaagaggcatatcacaggagagtttgagaagaaatatgttgct actcttggagtagaggtgcacccactgattttccacaccaacagaggagcgatcaagtat aatgtgtgggacacagctggtcaggagaagtttggaggcctgagagatggctactacatt caagctcagtgtgctatcatcatgttcgacgtcacttctcgagtcacctataagaacgtg cccaactggcatcgtgacctggtccgtgtctgtgagaacattcccattgttctttgtggc aacaaggtggacatcaaagacaggaaagtcaaagccaagagcattgtgtttcaccgcaag aagaacctgcagtactacgacatttctgccaaaagtaactacaactttgagaagcctttc ctgtggttagcaaggaagttgatcggtgatcccaacctggagtttgtggcaatgcctgcc cttgctcccccagaggtccagatggacccatcccttgctgctaagtatgaggaagagctt caagttgcatcacaaacagcactcccagatgaagaagatgacctctaa

DBGET integrated database retrieval system