Maylandia zebra (zebra mbuna): 101474498 Help Entry 101474498         CDS       T02814                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism mze  Maylandia zebra (zebra mbuna) Pathway mze03030   DNA replication mze03410   Base excision repair mze03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mze00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101474498 (pole4)    03410 Base excision repair     101474498 (pole4)    03420 Nucleotide excision repair     101474498 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mze03032]     101474498 (pole4)    03400 DNA repair and recombination proteins [BR:mze03400]     101474498 (pole4) Enzymes [BR:mze01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      101474498 (pole4) DNA replication proteins [BR:mze03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     101474498 (pole4) DNA repair and recombination proteins [BR:mze03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       101474498 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  101474498 NCBI-ProteinID:  XP_004554995 UniProt:  A0A3P9BRA5 LinkDB All DBs Position LG23:complement(3885339..3887704) Genome browser AA seq 129 aa AA seqDB search MAATVTTSLVTATEHDPDRCESEEETRGAEAEDSGQQQQTGPVTVSHSRLSKLPLSRIKA LMKTDPDVALASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE FAFLEGTLD NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggcagcaacagtgacgacgagtcttgtgaccgcaacggagcacgaccctgaccggtgt gagagtgaggaggagacccgcggggccgaggcggaggacagcggccagcagcagcagacg ggcccagtcacggtgagccacagccggctgtccaaactcccgctgtcccgcatcaaggct ctgatgaagaccgacccagacgtggccctcgccagccaggagtctgtgttcatcatcgct aaagccacggaattgtttgttgagatgatcgccaaagatgctctagtgtatgcacagcaa gggaagaggaaaactttgcaaagaaaagacttggacaatgcaatagaagccatagatgag tttgcatttcttgaaggcacactggattaa

DBGET integrated database retrieval system