Methanolobus zinderi: HWN40_07270 Help Entry HWN40_07270       CDS       T06665                                  Name (GenBank) ferredoxin family protein   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism mzi  Methanolobus zinderi Pathway mzi00280   Valine, leucine and isoleucine degradation mzi01100   Metabolic pathways mzi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mzi00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     HWN40_07270 Enzymes [BR:mzi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      HWN40_07270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_2 Fer4_17 Fer4_6 Fer4_8 Fer4_22 LdpA_Fe-S-bd Fer4_4 Fer4 Fer4_16 Fer4_3 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  QLC50056 UniProt:  A0A7D5EEH2 LinkDB All DBs Position complement(1473967..1474209) Genome browser AA seq 80 aa AA seqDB search MSDLQEKKEPYPVINIIECKACGRCIVACPKDLLKLSDDLNERGYHYVEYAGEGCTGCAN CYYTCPEPLAIEIHIPVKEK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcagatcttcaggaaaaaaaggaaccttacccggttatcaatattattgagtgtaag gcatgcggtcgttgcatagttgcatgccctaaagaccttcttaaattaagtgacgatctc aacgaaagaggctatcactatgtggagtatgcaggtgagggttgcacgggctgtgcaaac tgttactatacatgtcccgagccactcgcaatagagatccacattcccgtaaaagaaaaa taa

DBGET integrated database retrieval system