Mycetomoellerius zeteki: 108722168 Help Entry 108722168         CDS       T11078                                  Symbol kud Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mzt  Mycetomoellerius zeteki Pathway mzt00510   N-Glycan biosynthesis mzt00513   Various types of N-glycan biosynthesis mzt04141   Protein processing in endoplasmic reticulum Module mzt_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mzt00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     108722168 (kud)    00513 Various types of N-glycan biosynthesis     108722168 (kud)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108722168 (kud) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 CAAD Motif Other DBs NCBI-GeneID:  108722168 NCBI-ProteinID:  XP_018302642 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MVEIESMTRYVSPVNPAVFPLLAVVLLGIGVFFTAWFFVYEVTSTKFTRDICKEAIISLV AALFSSFGVLFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggttgaaatcgagtcgatgacgagatacgtctcgccggtgaaccctgctgtctttcct cttctggctgtggttctattaggaattggagtatttttcacggcctggttcttcgtatac gaagttaccagcacaaagtttacgcgagatatatgcaaggaagcaataatttccttggtc gcagcgctattctctagctttggagtattatttttgctgctctgggttggaatttatgta tag

DBGET integrated database retrieval system