Naasia aerilata: GCM126_29360 Help Entry GCM126_29360      CDS       T09129                                  Name (GenBank) hypothetical protein   KO K01803   triosephosphate isomerase (TIM) [EC:5.3.1.1] Organism naei  Naasia aerilata Pathway naei00010   Glycolysis / Gluconeogenesis naei00051   Fructose and mannose metabolism naei00562   Inositol phosphate metabolism naei00710   Carbon fixation by Calvin cycle naei01100   Metabolic pathways naei01110   Biosynthesis of secondary metabolites naei01120   Microbial metabolism in diverse environments naei01200   Carbon metabolism naei01230   Biosynthesis of amino acids Module naei_M00002   Glycolysis, core module involving three-carbon compounds naei_M00003   Gluconeogenesis, oxaloacetate => fructose-6P Brite KEGG Orthology (KO) [BR:naei00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     GCM126_29360    00051 Fructose and mannose metabolism     GCM126_29360    00562 Inositol phosphate metabolism     GCM126_29360   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     GCM126_29360  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:naei04147]     GCM126_29360 Enzymes [BR:naei01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.1  triose-phosphate isomerase      GCM126_29360 Exosome [BR:naei04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    GCM126_29360   Exosomal proteins of bladder cancer cells    GCM126_29360   Exosomal proteins of melanoma cells    GCM126_29360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TIM Ig_DR_A0283-like Motif Other DBs NCBI-ProteinID:  BDZ47027 LinkDB All DBs Position 2704529..2704930 Genome browser AA seq 133 aa AA seqDB search MAAVSRVPLIAGNWKMNLDHLQAIAFVQKLAWTLKDAGHDYRETEVAIFPPFTDLRSVQT LISADKYELALGGQDLSQHDSGAYTGRSPARSSPLSRRSTCSSVTPSGASTTARPTRSSG PRSWPLCATASSR NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggcagccgtgagccgggtcccgctcatcgcgggcaactggaagatgaacctcgaccac ctgcaggcgatcgcgttcgtccagaagctcgcctggacgctcaaggacgccggtcacgac taccgcgagaccgaggtggcgatcttcccgccgttcacggacctgcggagcgtgcagacc ctcatctcggcggacaagtacgagctcgcgctgggcggccaggacctctcccagcacgac tcgggtgcgtacacggggagatctccggcgcgttcctcgccgctctcgaggcgaagtacg tgctcatcggtcactccgagcggcgcatccaccacggcgagaccgacgagatcgtcgggg ccaaggtcgtggccgctctgcgccacggcctcatcccggtga

DBGET integrated database retrieval system