Necator americanus (New World hookworm): NECAME_06523 Help Entry NECAME_06523      CDS       T04867                                  Name (RefSeq) hypothetical protein   KO K19385   transmembrane protein 216 Organism nai  Necator americanus (New World hookworm) Brite KEGG Orthology (KO) [BR:nai00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nai03037]     NECAME_06523 Cilium and associated proteins [BR:nai03037]  Primary cilia and associated proteins   MKS complex    NECAME_06523 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Transmemb_17 Motif Other DBs NCBI-GeneID:  25346555 NCBI-ProteinID:  XP_013307455 UniProt:  W2TTW5 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search LSSFPEKASIGIDTSNCDCSVLPYQYHVRVLELLIILAFAPIEAIRLSWGSRGNLTETPV FLGFSILLSVPLLLILLYLAVFQNYGRSHFKQT NT seq 282 nt NT seq  +upstreamnt  +downstreamnt ttatcctcttttcccgaaaaggcttcgatcggaattgatacctctaactgtgactgttca gttttaccctaccaatatcacgtacgtgttctagaactcctgataatacttgcatttgca ccgattgaagctatacgactatcgtggggaagccgaggaaacttgacggaaacgccggtc tttctgggattctcgatacttcttagcgttcctttgttattgattctcctctacttggcc gtttttcagaactatggtaggagccatttcaaacaaacataa

DBGET integrated database retrieval system