Numenius arquata (Eurasian curlew): 141475471 Help Entry 141475471         CDS       T11436                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism narq  Numenius arquata (Eurasian curlew) Pathway narq03030   DNA replication narq03410   Base excision repair narq03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:narq00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     141475471 (POLE4)    03410 Base excision repair     141475471 (POLE4)    03420 Nucleotide excision repair     141475471 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:narq03032]     141475471 (POLE4)    03400 DNA repair and recombination proteins [BR:narq03400]     141475471 (POLE4) Enzymes [BR:narq01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      141475471 (POLE4) DNA replication proteins [BR:narq03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     141475471 (POLE4) DNA repair and recombination proteins [BR:narq03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       141475471 (POLE4) SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa SlpA CENP-S Motif Other DBs NCBI-GeneID:  141475471 NCBI-ProteinID:  XP_074019947 LinkDB All DBs Position 25:complement(698702..701283) Genome browser AA seq 116 aa AA seqDB search MAAAAGAVPVAVPVAGAEAAVPGEEAAGAGPPGPARLARLPLARVKALVKADPDVSLASQ EAVFVLARATELFVETIAKDAYVYAQQGKRKTLQRKDLDNAIEAIDEFAFLEGTLD NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcgggggccgtgccggtggcggtgccggtggcgggcgcggaggcggcg gtgccgggggaggaggcagcgggcgcggggccgccggggccggcccgcctggcgcggctg ccgctggcgcgcgtgaaagcgctggtgaaggcggacccggacgtcagcctggccagccag gaggccgtcttcgtcctggcgcgggccacggagttgtttgttgaaaccatagccaaagat gcttacgtgtacgctcagcaaggaaaaaggaaaactctgcagagaaaagacctggataat gccattgaagctattgatgaatttgcttttttggaaggtactttggactga

DBGET integrated database retrieval system