Nicotiana attenuata (coyote tobacco): 109221000 Help Entry 109221000         CDS       T05870                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau03420   Nucleotide excision repair nau04120   Ubiquitin mediated proteolysis nau04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109221000    04120 Ubiquitin mediated proteolysis     109221000   09124 Replication and repair    03420 Nucleotide excision repair     109221000  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nau04121]     109221000    03400 DNA repair and recombination proteins [BR:nau03400]     109221000 Enzymes [BR:nau01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109221000 Ubiquitin system [BR:nau04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109221000   Multi subunit type E3    SCF complex     Ring finger protein      109221000    Cul2 complex      109221000    Cul3 complex      109221000    Cul4 complex      109221000    Cul7 complex      109221000    Cul8 complex      109221000    Cul9 complex      109221000 DNA repair and recombination proteins [BR:nau03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109221000     TCR (transcription coupled repair) factors      Cul4-CSA complex       109221000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  109221000 NCBI-ProteinID:  XP_019241012 UniProt:  A0A1J6K412 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MDIDVEMVPAGEESNAAAAAPSSASAASSSTKKPKRFEIKKWNAVALWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggatatagacgtcgagatggttcccgccggtgaagaatccaacgctgcagcagcagca ccttcatcagcatctgctgcttcttcttccactaagaaacctaaacgttttgagatcaaa aaatggaatgctgttgctctttgggcttgggatatcgttgtagacaactgtgctatttgc aggaatcatattatggatctatgcatcgaatgccaagctaatcaagctagtgctacgagc gaggagtgcactgttgcttggggtgtatgtaaccatgccttccacttccactgcatcagt cgctggctcaaaacccgtcaagtgtgtccattagataatagtgagtgggaatttcagaag tatggtcactag

DBGET integrated database retrieval system