Nicotiana attenuata (coyote tobacco): 109225596 Help Entry 109225596         CDS       T05870                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau03420   Nucleotide excision repair nau04120   Ubiquitin mediated proteolysis nau04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109225596    04120 Ubiquitin mediated proteolysis     109225596   09124 Replication and repair    03420 Nucleotide excision repair     109225596  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nau04121]     109225596    03400 DNA repair and recombination proteins [BR:nau03400]     109225596 Enzymes [BR:nau01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109225596 Ubiquitin system [BR:nau04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109225596   Multi subunit type E3    SCF complex     Ring finger protein      109225596    Cul2 complex      109225596    Cul3 complex      109225596    Cul4 complex      109225596    Cul7 complex      109225596    Cul8 complex      109225596    Cul9 complex      109225596 DNA repair and recombination proteins [BR:nau03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109225596     TCR (transcription coupled repair) factors      Cul4-CSA complex       109225596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  109225596 NCBI-ProteinID:  XP_019245859 LinkDB All DBs Position 5:complement(31006995..31013112) Genome browser AA seq 120 aa AA seqDB search MASVDTDVTMVPAGEGSTGAGASSSSSTKKAKRFEIKKWNAVSLWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcatctgtcgacaccgacgtgactatggttccggccggcgagggttctaccggtgcc ggagcttcatcatcatcttccactaagaaggccaagcgttttgagataaaaaagtggaac gctgtctctctatgggcttgggatattgtggtcgataactgtgctatctgtaggaaccac atcatggatctctgtattgaatgtcaagctaatcaagctagtgcaacaagtgaggaatgc acagtggcttggggagtttgcaaccatgcgttccacttccactgcattagtaggtggctc aagactcgtcaagtctgtcctcttgacaacagtgagtgggagtttcagaaatatggtcac tag

DBGET integrated database retrieval system