Nicotiana attenuata (coyote tobacco): 109228482 Help Entry 109228482         CDS       T05870                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism nau  Nicotiana attenuata (coyote tobacco) Pathway nau00510   N-Glycan biosynthesis nau00513   Various types of N-glycan biosynthesis nau04141   Protein processing in endoplasmic reticulum Module nau_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:nau00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109228482    00513 Various types of N-glycan biosynthesis     109228482  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109228482 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF7315 Motif Other DBs NCBI-GeneID:  109228482 NCBI-ProteinID:  XP_019249126 LinkDB All DBs Position 7:complement(936291..939968) Genome browser AA seq 78 aa AA seqDB search MAQSAKPISSPVPESLYPTLAVFMLAIGLVVTASFLIYEATSSRKNRSLAKELTSGAVAS VFLGFGSLFLLLASGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctcaatcagcaaaaccgatctcgagtccagtccctgagtcgttgtacccaactcta gccgtgttcatgctcgctattggtcttgtcgtaacggcttctttcctcatctatgaagct acttcttcaaggaagaatcgcagccttgcaaaggagctcacgagtggggcagtagcatct gttttcttgggttttggatcattgttcttgctgcttgcgtcaggcgtgtatgtttga

DBGET integrated database retrieval system