KEGG   Natronorubrum bangense: DV706_11390
Entry
DV706_11390       CDS       T05942                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
nbg  Natronorubrum bangense
Pathway
nbg00053  Ascorbate and aldarate metabolism
nbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    DV706_11390
Enzymes [BR:nbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     DV706_11390
SSDB
Motif
Pfam: Epimerase NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_10 DapB_N GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: QCC55020
UniProt: A0A4D6HMH2
LinkDB
Position
2268916..2269686
AA seq 256 aa
MTNIAITGASGRVGNEAIEALSADSLTLFSHSETEELETEPIDIANRETFVDALEGQDVL
LHLAANPDPRAEWDALTGPNIEGVYNAYAAALENDLERVVFASSNHAVNMGNTVSSIRPE
STVGKPDIVRPDETMDPDTYYGVTKVFGEAMGHYYATRHGLDVVNLRIGWLLSRDELRAE
CAERDAAGERYARAMWLSSDDCRRVIDAAVTTTLDSNPTVAHGISDNSERFLSLSETMLE
LGYWPQDDSAAVLEDR
NT seq 771 nt   +upstreamnt  +downstreamnt
atgacgaacatcgcgatcactggcgcatccggacgggttggtaacgaagccatcgaggca
ctctcggccgactcactcacactgttttcacacagcgaaaccgaggagctggagacggaa
ccgatagacatcgcgaaccgggagacgttcgtcgacgccctcgagggacaggacgtgttg
ctccatctcgcagccaacccggacccgcgcgccgagtgggatgccctcactggacccaat
atcgagggcgtctacaacgcctacgcggccgccctcgagaacgacttagagcgcgtcgtc
ttcgcgagttcgaaccacgcggtcaatatgggaaacaccgtctcgtcgatccggccggag
tcgacggtcgggaaaccagatatcgttcgcccggacgagacgatggatccggacacctac
tacggcgtcaccaaggtcttcggcgaggcgatgggccactattatgcgacccggcacgga
ctcgacgtggtcaacttacggatcgggtggttgctgtctcgagacgaactcagagcggag
tgtgccgaacgcgatgctgctggcgagcgatacgcccgcgcgatgtggctcagttccgac
gactgtcgacgggtgatcgatgcggccgtgacaacgacgctcgattcgaacccgacggtc
gcccacggaatctcggataactccgagcgatttctctcgctgtcggagacgatgctcgag
ttgggatattggccacaggacgactcggccgccgtcctcgaggaccgttga

DBGET integrated database retrieval system