Sciurus carolinensis (gray squirrel): 124965545 Help Entry 124965545         CDS       T08117                                  Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01521   EGFR tyrosine kinase inhibitor resistance ncar01522   Endocrine resistance ncar01524   Platinum drug resistance ncar04064   NF-kappa B signaling pathway ncar04066   HIF-1 signaling pathway ncar04071   Sphingolipid signaling pathway ncar04115   p53 signaling pathway ncar04140   Autophagy - animal ncar04141   Protein processing in endoplasmic reticulum ncar04151   PI3K-Akt signaling pathway ncar04210   Apoptosis ncar04215   Apoptosis - multiple species ncar04217   Necroptosis ncar04261   Adrenergic signaling in cardiomyocytes ncar04340   Hedgehog signaling pathway ncar04510   Focal adhesion ncar04621   NOD-like receptor signaling pathway ncar04630   JAK-STAT signaling pathway ncar04722   Neurotrophin signaling pathway ncar04725   Cholinergic synapse ncar04915   Estrogen signaling pathway ncar04928   Parathyroid hormone synthesis, secretion and action ncar04933   AGE-RAGE signaling pathway in diabetic complications ncar05014   Amyotrophic lateral sclerosis ncar05022   Pathways of neurodegeneration - multiple diseases ncar05132   Salmonella infection ncar05145   Toxoplasmosis ncar05152   Tuberculosis ncar05161   Hepatitis B ncar05162   Measles ncar05168   Herpes simplex virus 1 infection ncar05169   Epstein-Barr virus infection ncar05170   Human immunodeficiency virus 1 infection ncar05200   Pathways in cancer ncar05206   MicroRNAs in cancer ncar05207   Chemical carcinogenesis - receptor activation ncar05210   Colorectal cancer ncar05215   Prostate cancer ncar05222   Small cell lung cancer ncar05226   Gastric cancer ncar05417   Lipid and atherosclerosis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124965545  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     124965545    04630 JAK-STAT signaling pathway     124965545    04064 NF-kappa B signaling pathway     124965545    04066 HIF-1 signaling pathway     124965545    04071 Sphingolipid signaling pathway     124965545    04151 PI3K-Akt signaling pathway     124965545  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124965545   09143 Cell growth and death    04210 Apoptosis     124965545    04215 Apoptosis - multiple species     124965545    04217 Necroptosis     124965545    04115 p53 signaling pathway     124965545   09144 Cellular community - eukaryotes    04510 Focal adhesion     124965545  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     124965545   09152 Endocrine system    04915 Estrogen signaling pathway     124965545    04928 Parathyroid hormone synthesis, secretion and action     124965545   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     124965545   09156 Nervous system    04725 Cholinergic synapse     124965545    04722 Neurotrophin signaling pathway     124965545  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124965545    05206 MicroRNAs in cancer     124965545    05207 Chemical carcinogenesis - receptor activation     124965545   09162 Cancer: specific types    05210 Colorectal cancer     124965545    05226 Gastric cancer     124965545    05215 Prostate cancer     124965545    05222 Small cell lung cancer     124965545   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     124965545    05161 Hepatitis B     124965545    05162 Measles     124965545    05168 Herpes simplex virus 1 infection     124965545    05169 Epstein-Barr virus infection     124965545   09171 Infectious disease: bacterial    05132 Salmonella infection     124965545    05152 Tuberculosis     124965545   09174 Infectious disease: parasitic    05145 Toxoplasmosis     124965545   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     124965545    05022 Pathways of neurodegeneration - multiple diseases     124965545   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124965545    05418 Fluid shear stress and atherosclerosis     124965545   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     124965545   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     124965545    01524 Platinum drug resistance     124965545    01522 Endocrine resistance     124965545  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ncar01009]     124965545 Protein phosphatases and associated proteins [BR:ncar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      124965545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  124965545 NCBI-ProteinID:  XP_047382525 LinkDB All DBs Position 15:complement(68673769..68839281) Genome browser AA seq 239 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGATPVPGIFSSQPGRNPPPA APQDPAARTSPPPPPAAPAAAAGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggctcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tataagctgtcacagaggggctacgagtgggatgctggagacgcgggcgctgcgccccca ggggccacccccgtgccgggcatcttctcttcccagcccgggcgcaaccccccgcccgct gcgccccaggacccagcagccaggacctcaccaccgccacccccggctgcccccgctgcc gccgcggggcctgtgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc ggcgatgacttctctcgtcgctatcgccgcgacttcgccgagatgtccagtcagctgcac ctgacgcccttcaccgcgaggggacgctttgccacggtggtggaggagctcttcagggac ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac ctgaaccggcacctgcacacctggatccaggataacggaggctgggacgccttcgtggaa ctgtacggccccagcgtgcggcccctgtttgacttctcctggctgtctctgaagactctg ctcagcctggccctggtgggagcctgcatcaccctgggggcctacctgggccacaagtga

DBGET integrated database retrieval system