Sciurus carolinensis (gray squirrel): 124977967 Help Entry 124977967         CDS       T08117                                  Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01522   Endocrine resistance ncar04010   MAPK signaling pathway ncar04024   cAMP signaling pathway ncar04210   Apoptosis ncar04380   Osteoclast differentiation ncar04620   Toll-like receptor signaling pathway ncar04657   IL-17 signaling pathway ncar04658   Th1 and Th2 cell differentiation ncar04659   Th17 cell differentiation ncar04660   T cell receptor signaling pathway ncar04662   B cell receptor signaling pathway ncar04668   TNF signaling pathway ncar04713   Circadian entrainment ncar04725   Cholinergic synapse ncar04728   Dopaminergic synapse ncar04915   Estrogen signaling pathway ncar04917   Prolactin signaling pathway ncar04921   Oxytocin signaling pathway ncar04926   Relaxin signaling pathway ncar04928   Parathyroid hormone synthesis, secretion and action ncar04932   Non-alcoholic fatty liver disease ncar04935   Growth hormone synthesis, secretion and action ncar05031   Amphetamine addiction ncar05132   Salmonella infection ncar05133   Pertussis ncar05135   Yersinia infection ncar05140   Leishmaniasis ncar05142   Chagas disease ncar05161   Hepatitis B ncar05162   Measles ncar05166   Human T-cell leukemia virus 1 infection ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05170   Human immunodeficiency virus 1 infection ncar05171   Coronavirus disease - COVID-19 ncar05200   Pathways in cancer ncar05207   Chemical carcinogenesis - receptor activation ncar05208   Chemical carcinogenesis - reactive oxygen species ncar05210   Colorectal cancer ncar05224   Breast cancer ncar05231   Choline metabolism in cancer ncar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ncar05323   Rheumatoid arthritis ncar05417   Lipid and atherosclerosis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124977967    04668 TNF signaling pathway     124977967    04024 cAMP signaling pathway     124977967  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     124977967  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124977967    04660 T cell receptor signaling pathway     124977967    04658 Th1 and Th2 cell differentiation     124977967    04659 Th17 cell differentiation     124977967    04657 IL-17 signaling pathway     124977967    04662 B cell receptor signaling pathway     124977967   09152 Endocrine system    04915 Estrogen signaling pathway     124977967    04917 Prolactin signaling pathway     124977967    04921 Oxytocin signaling pathway     124977967    04926 Relaxin signaling pathway     124977967    04935 Growth hormone synthesis, secretion and action     124977967    04928 Parathyroid hormone synthesis, secretion and action     124977967   09156 Nervous system    04725 Cholinergic synapse     124977967    04728 Dopaminergic synapse     124977967   09158 Development and regeneration    04380 Osteoclast differentiation     124977967   09159 Environmental adaptation    04713 Circadian entrainment     124977967  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124977967    05207 Chemical carcinogenesis - receptor activation     124977967    05208 Chemical carcinogenesis - reactive oxygen species     124977967    05231 Choline metabolism in cancer     124977967    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124977967   09162 Cancer: specific types    05210 Colorectal cancer     124977967    05224 Breast cancer     124977967   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124977967    05170 Human immunodeficiency virus 1 infection     124977967    05161 Hepatitis B     124977967    05171 Coronavirus disease - COVID-19     124977967    05162 Measles     124977967    05167 Kaposi sarcoma-associated herpesvirus infection     124977967   09171 Infectious disease: bacterial    05132 Salmonella infection     124977967    05135 Yersinia infection     124977967    05133 Pertussis     124977967   09174 Infectious disease: parasitic    05140 Leishmaniasis     124977967    05142 Chagas disease     124977967   09163 Immune disease    05323 Rheumatoid arthritis     124977967   09165 Substance dependence    05031 Amphetamine addiction     124977967   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124977967    05418 Fluid shear stress and atherosclerosis     124977967   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     124977967   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     124977967  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ncar03000]     124977967    04131 Membrane trafficking [BR:ncar04131]     124977967 Transcription factors [BR:ncar03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     124977967 Membrane trafficking [BR:ncar04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     124977967 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  124977967 NCBI-ProteinID:  XP_047397873 LinkDB All DBs Position 2:173487416..173490811 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDMAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSTGAYSRAGVAKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFA LPLLNDPEPKPSVEPVKSINSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tctccggccggggacaatctctcctactaccattccccggccgactccttctccagcatg ggctctcctgtcaatgcacaggacttctgcacggatatggctgtctccagtgccaacttc atccccacggtgactgctatctcgaccagcccggacctgcaatggctggtgcaacccacc ttggtctcctctgtggctccatcgcagaccagagctccccacccctacggagtccccact ccctcgactggagcttactccagggctggagtggcaaagaccatgacagggggcagagca cagagcatcggcaggaggggcaaggtagaacagttgtctcctgaagaagaagagaaaagg agaattcgaagggaaaggaataagatggctgcagccaagtgccgaaaccggaggagggag ctgactgatacactccaggcggagacagaccaacttgaagatgagaagtctgctctgcag actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggctgctcac cgacctgcctgcaagatccctgatgacctgggcttcccagaagaaatgtctgtggcatcc ctggatttgagtgggggcctgccagaggctgccaccccagaatctgaggaggcctttgcc ctgcccctcctcaatgaccctgaacccaagccatcggtggagccggtcaaaagcatcaac agcatggagctgaaggctgagccctttgatgacttcctgttcccggcatcgtccaggccc agcggctctgagacagcccgctccgtgccagacatggacctgtctggttccttctacgca gcagactgggagcccctgcacagcagctccctggggatggggcccatggtcactgagttg gagcccctgtgcacccccgtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcactcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system