Sciurus carolinensis (gray squirrel): 124982482 Help Entry 124982482         CDS       T08117                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04010   MAPK signaling pathway ncar04014   Ras signaling pathway ncar04015   Rap1 signaling pathway ncar04024   cAMP signaling pathway ncar04062   Chemokine signaling pathway ncar04510   Focal adhesion ncar04517   IgSF CAM signaling ncar04520   Adherens junction ncar04611   Platelet activation ncar04670   Leukocyte transendothelial migration ncar04720   Long-term potentiation ncar04722   Neurotrophin signaling pathway ncar04934   Cushing syndrome ncar04972   Pancreatic secretion ncar05211   Renal cell carcinoma ncar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124982482    04014 Ras signaling pathway     124982482    04015 Rap1 signaling pathway     124982482    04024 cAMP signaling pathway     124982482   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     124982482  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     124982482    04520 Adherens junction     124982482  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     124982482    04670 Leukocyte transendothelial migration     124982482    04062 Chemokine signaling pathway     124982482   09154 Digestive system    04972 Pancreatic secretion     124982482   09156 Nervous system    04720 Long-term potentiation     124982482    04722 Neurotrophin signaling pathway     124982482  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     124982482   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124982482   09167 Endocrine and metabolic disease    04934 Cushing syndrome     124982482  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124982482    04031 GTP-binding proteins [BR:ncar04031]     124982482 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124982482   Exosomal proteins of other body fluids (saliva and urine)    124982482   Exosomal proteins of colorectal cancer cells    124982482 GTP-binding proteins [BR:ncar04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     124982482 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  124982482 NCBI-ProteinID:  XP_047405162 LinkDB All DBs Position 4:127724877..127767461 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataagctagtcgttcttggctcaggaggggttggaaagtctgctctgact gtacaatttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtatatgaaaaatggacaaggctttgcttta gtttattccatcacagcacagtctacctttaatgatttacaagatctgagagaacaaatt cttcgagttaaagacactgatgatgttcccatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system