Sciurus carolinensis (gray squirrel): 124983352 Help Entry 124983352         CDS       T08117                                  Name (RefSeq) interferon gamma-like   KO K04687   interferon gamma Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar03050   Proteasome ncar04060   Cytokine-cytokine receptor interaction ncar04066   HIF-1 signaling pathway ncar04217   Necroptosis ncar04350   TGF-beta signaling pathway ncar04380   Osteoclast differentiation ncar04612   Antigen processing and presentation ncar04630   JAK-STAT signaling pathway ncar04650   Natural killer cell mediated cytotoxicity ncar04657   IL-17 signaling pathway ncar04658   Th1 and Th2 cell differentiation ncar04659   Th17 cell differentiation ncar04660   T cell receptor signaling pathway ncar04940   Type I diabetes mellitus ncar05140   Leishmaniasis ncar05142   Chagas disease ncar05143   African trypanosomiasis ncar05144   Malaria ncar05145   Toxoplasmosis ncar05146   Amoebiasis ncar05152   Tuberculosis ncar05160   Hepatitis C ncar05164   Influenza A ncar05168   Herpes simplex virus 1 infection ncar05200   Pathways in cancer ncar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ncar05321   Inflammatory bowel disease ncar05322   Systemic lupus erythematosus ncar05323   Rheumatoid arthritis ncar05330   Allograft rejection ncar05332   Graft-versus-host disease ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     124983352  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     124983352    04630 JAK-STAT signaling pathway     124983352    04066 HIF-1 signaling pathway     124983352   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124983352  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     124983352  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     124983352    04612 Antigen processing and presentation     124983352    04660 T cell receptor signaling pathway     124983352    04658 Th1 and Th2 cell differentiation     124983352    04659 Th17 cell differentiation     124983352    04657 IL-17 signaling pathway     124983352   09158 Development and regeneration    04380 Osteoclast differentiation     124983352  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124983352    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124983352   09172 Infectious disease: viral    05160 Hepatitis C     124983352    05164 Influenza A     124983352    05168 Herpes simplex virus 1 infection     124983352   09171 Infectious disease: bacterial    05152 Tuberculosis     124983352   09174 Infectious disease: parasitic    05146 Amoebiasis     124983352    05144 Malaria     124983352    05145 Toxoplasmosis     124983352    05140 Leishmaniasis     124983352    05142 Chagas disease     124983352    05143 African trypanosomiasis     124983352   09163 Immune disease    05322 Systemic lupus erythematosus     124983352    05323 Rheumatoid arthritis     124983352    05321 Inflammatory bowel disease     124983352    05330 Allograft rejection     124983352    05332 Graft-versus-host disease     124983352   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     124983352   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     124983352  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ncar03051]     124983352   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124983352    00536 Glycosaminoglycan binding proteins [BR:ncar00536]     124983352 Proteasome [BR:ncar03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     124983352 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Interferons    124983352 Glycosaminoglycan binding proteins [BR:ncar00536]  Heparan sulfate / Heparin   Cytokines    124983352 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 DUF7774 TssR_C T26-6p_Ig-like_dom Motif Other DBs NCBI-GeneID:  124983352 NCBI-ProteinID:  XP_047406527 LinkDB All DBs Position 4:complement(127292479..127297097) Genome browser AA seq 166 aa AA seqDB search MKYTSYFLAFQLCIILGSSSCYSQASINKEIENLKEYFNASTSDVGDGEPLFLDIMNNWK EESDQKVIQSQIVSFYFKLFEHLKNNKIIQKSMDTIKEDLIVKFFNSSVSKLEDFLKVSQ IQVNDLQVQRKAISELFKVMSDLSPRSTLRKRKRSQSSILGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatacacaagttatttcttggcctttcagctctgcatcattttgggatcttccagc tgttactcccaagcctcaattaataaagaaatagaaaatttaaaagaatattttaatgca agtacttcagatgtgggagatggggagcctcttttcttggatattatgaataactggaag gaagagagtgaccaaaaagtaattcagagccaaattgtctctttctacttcaaactcttt gaacacttaaaaaacaacaagatcatccaaaagagcatggacaccatcaaggaggacctg attgttaagttcttcaatagcagtgtcagcaaactggaggacttcttaaaggtgtctcaa attcaggtaaatgacctgcaggtccagcgcaaagcaatcagtgagctcttcaaagtgatg agtgatctgtcaccaagatctaccctaaggaagcgaaaaaggagtcagtcttcgattctg ggtcggagagcatccaaataa

DBGET integrated database retrieval system