Sciurus carolinensis (gray squirrel): 124983907 Help Entry 124983907         CDS       T08117                                  Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01522   Endocrine resistance ncar04110   Cell cycle ncar04115   p53 signaling pathway ncar04151   PI3K-Akt signaling pathway ncar04218   Cellular senescence ncar04530   Tight junction ncar04660   T cell receptor signaling pathway ncar04933   AGE-RAGE signaling pathway in diabetic complications ncar04934   Cushing syndrome ncar05160   Hepatitis C ncar05162   Measles ncar05163   Human cytomegalovirus infection ncar05164   Influenza A ncar05165   Human papillomavirus infection ncar05166   Human T-cell leukemia virus 1 infection ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05169   Epstein-Barr virus infection ncar05200   Pathways in cancer ncar05203   Viral carcinogenesis ncar05212   Pancreatic cancer ncar05214   Glioma ncar05218   Melanoma ncar05219   Bladder cancer ncar05220   Chronic myeloid leukemia ncar05222   Small cell lung cancer ncar05223   Non-small cell lung cancer ncar05224   Breast cancer ncar05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     124983907  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     124983907    04115 p53 signaling pathway     124983907    04218 Cellular senescence     124983907   09144 Cellular community - eukaryotes    04530 Tight junction     124983907  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     124983907  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124983907    05203 Viral carcinogenesis     124983907   09162 Cancer: specific types    05212 Pancreatic cancer     124983907    05225 Hepatocellular carcinoma     124983907    05214 Glioma     124983907    05220 Chronic myeloid leukemia     124983907    05218 Melanoma     124983907    05219 Bladder cancer     124983907    05224 Breast cancer     124983907    05222 Small cell lung cancer     124983907    05223 Non-small cell lung cancer     124983907   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124983907    05160 Hepatitis C     124983907    05164 Influenza A     124983907    05162 Measles     124983907    05163 Human cytomegalovirus infection     124983907    05167 Kaposi sarcoma-associated herpesvirus infection     124983907    05169 Epstein-Barr virus infection     124983907    05165 Human papillomavirus infection     124983907   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     124983907    04934 Cushing syndrome     124983907   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     124983907  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ncar01001]     124983907 Enzymes [BR:ncar01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      124983907 Protein kinases [BR:ncar01001]  Serine/threonine kinases: CMGC group   CDK family    124983907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  124983907 NCBI-ProteinID:  XP_047407526 LinkDB All DBs Position 4:complement(117837120..117840113) Genome browser AA seq 302 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPTETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEED PE NT seq 909 nt NT seq  +upstreamnt  +downstreamnt atggctacctcacgatatgaaccagtggcagaaattggtgtcggtgcctacgggacggtg tacaaagcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtgccc aatggaggaggagctggagggggccttcccatcagcacagttcgtgaagtggccttactg aggcgcctggaggcttttgaacatcccaatgttgtccggctgatggatgtttgtgccact tcccggactgaccgggaaatcaaggtgaccctagtgtttgagcatgttgaccaagaccta aggacttatctggacaaggcaccaccacctggcttgccaactgagaccatcaaggatctg atgcgccagtttctaagaggcctggattttcttcatgccaattgcatcgttcatcgggac ctgaagccagaaaatattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatatacagctaccagatggcccttacacctgtggttgttacactctggtat cgtgctcctgaagttcttctgcagtctacatatgcaacccctgtggacatgtggagcgtt ggctgtatctttgcagagatgtttcgtcggaagccactcttctgtggaaactctgaagct gaccagttgggcaaaatctttgacctgatcgggctgcctccagaggatgactggccccga gatgtatctctaccccgaggagcctttccccccagaggacctcgccctgtgcagtcagtg gtgcctgagatggaagaatctggagctcagttgctcctggaaatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggaagaggat ccagagtga

DBGET integrated database retrieval system