Sciurus carolinensis (gray squirrel): 124986432 Help Entry 124986432         CDS       T08117                                  Name (RefSeq) interleukin-4-like   KO K05430   interleukin 4 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04060   Cytokine-cytokine receptor interaction ncar04151   PI3K-Akt signaling pathway ncar04630   JAK-STAT signaling pathway ncar04640   Hematopoietic cell lineage ncar04657   IL-17 signaling pathway ncar04658   Th1 and Th2 cell differentiation ncar04659   Th17 cell differentiation ncar04660   T cell receptor signaling pathway ncar04664   Fc epsilon RI signaling pathway ncar04672   Intestinal immune network for IgA production ncar05140   Leishmaniasis ncar05200   Pathways in cancer ncar05310   Asthma ncar05320   Autoimmune thyroid disease ncar05321   Inflammatory bowel disease ncar05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     124986432    04151 PI3K-Akt signaling pathway     124986432   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124986432  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     124986432    04660 T cell receptor signaling pathway     124986432    04658 Th1 and Th2 cell differentiation     124986432    04659 Th17 cell differentiation     124986432    04657 IL-17 signaling pathway     124986432    04664 Fc epsilon RI signaling pathway     124986432    04672 Intestinal immune network for IgA production     124986432  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124986432   09174 Infectious disease: parasitic    05140 Leishmaniasis     124986432   09163 Immune disease    05310 Asthma     124986432    05320 Autoimmune thyroid disease     124986432    05321 Inflammatory bowel disease     124986432    05330 Allograft rejection     124986432  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124986432    00536 Glycosaminoglycan binding proteins [BR:ncar00536]     124986432 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Interleukins    124986432 Glycosaminoglycan binding proteins [BR:ncar00536]  Heparan sulfate / Heparin   Cytokines    124986432 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  124986432 NCBI-ProteinID:  XP_047410752 LinkDB All DBs Position 6:complement(137653049..137660788) Genome browser AA seq 148 aa AA seqDB search MGLTPQLIATLCCLLVCSGDFTHGCDVTLEEIIKTLNTLSGKKTTCMELMVADVFAVPQN TTEKEILCRATTVLRQIYRNHPVPTCLNKNGKLDILKFLRGLYRNLHSMAQLHNCPMSES KQRPLKDFLESLRSTMQKKYSECGRSMF NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgggtctcaccccccagctgattgccactctctgctgtcttctagtatgctctggcgac ttcacccatggatgcgatgttaccttggaagagatcatcaaaactttgaacacactctca gggaaaaagactacatgcatggagctgatggtagcagacgtctttgctgtcccccagaac acaaccgagaaagaaattctctgcagggctacaactgtgcttcggcagatctatcgaaac cacccagtgcctacatgtttgaacaaaaatggaaaacttgacattctcaaattcctgcga ggactctacaggaacctccacagtatggcccagctgcacaactgtcctatgagtgaatcc aagcagagacccctgaaagacttcttggaaagtctgagaagtaccatgcaaaagaaatat tcagaatgtggaaggtcaatgttttaa

DBGET integrated database retrieval system