Sciurus carolinensis (gray squirrel): 124988890 Help Entry 124988890         CDS       T08117                                  Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01523   Antifolate resistance ncar04010   MAPK signaling pathway ncar04060   Cytokine-cytokine receptor interaction ncar04061   Viral protein interaction with cytokine and cytokine receptor ncar04064   NF-kappa B signaling pathway ncar04071   Sphingolipid signaling pathway ncar04150   mTOR signaling pathway ncar04210   Apoptosis ncar04217   Necroptosis ncar04350   TGF-beta signaling pathway ncar04380   Osteoclast differentiation ncar04612   Antigen processing and presentation ncar04620   Toll-like receptor signaling pathway ncar04621   NOD-like receptor signaling pathway ncar04622   RIG-I-like receptor signaling pathway ncar04625   C-type lectin receptor signaling pathway ncar04640   Hematopoietic cell lineage ncar04650   Natural killer cell mediated cytotoxicity ncar04657   IL-17 signaling pathway ncar04660   T cell receptor signaling pathway ncar04664   Fc epsilon RI signaling pathway ncar04668   TNF signaling pathway ncar04920   Adipocytokine signaling pathway ncar04930   Type II diabetes mellitus ncar04931   Insulin resistance ncar04932   Non-alcoholic fatty liver disease ncar04933   AGE-RAGE signaling pathway in diabetic complications ncar04936   Alcoholic liver disease ncar04940   Type I diabetes mellitus ncar05010   Alzheimer disease ncar05014   Amyotrophic lateral sclerosis ncar05020   Prion disease ncar05022   Pathways of neurodegeneration - multiple diseases ncar05132   Salmonella infection ncar05133   Pertussis ncar05134   Legionellosis ncar05135   Yersinia infection ncar05140   Leishmaniasis ncar05142   Chagas disease ncar05143   African trypanosomiasis ncar05144   Malaria ncar05145   Toxoplasmosis ncar05146   Amoebiasis ncar05152   Tuberculosis ncar05160   Hepatitis C ncar05161   Hepatitis B ncar05163   Human cytomegalovirus infection ncar05164   Influenza A ncar05165   Human papillomavirus infection ncar05166   Human T-cell leukemia virus 1 infection ncar05168   Herpes simplex virus 1 infection ncar05169   Epstein-Barr virus infection ncar05170   Human immunodeficiency virus 1 infection ncar05171   Coronavirus disease - COVID-19 ncar05205   Proteoglycans in cancer ncar05310   Asthma ncar05321   Inflammatory bowel disease ncar05322   Systemic lupus erythematosus ncar05323   Rheumatoid arthritis ncar05330   Allograft rejection ncar05332   Graft-versus-host disease ncar05410   Hypertrophic cardiomyopathy ncar05414   Dilated cardiomyopathy ncar05417   Lipid and atherosclerosis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124988890    04350 TGF-beta signaling pathway     124988890    04064 NF-kappa B signaling pathway     124988890    04668 TNF signaling pathway     124988890    04071 Sphingolipid signaling pathway     124988890    04150 mTOR signaling pathway     124988890   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124988890    04061 Viral protein interaction with cytokine and cytokine receptor     124988890  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     124988890    04217 Necroptosis     124988890  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     124988890    04620 Toll-like receptor signaling pathway     124988890    04621 NOD-like receptor signaling pathway     124988890    04622 RIG-I-like receptor signaling pathway     124988890    04625 C-type lectin receptor signaling pathway     124988890    04650 Natural killer cell mediated cytotoxicity     124988890    04612 Antigen processing and presentation     124988890    04660 T cell receptor signaling pathway     124988890    04657 IL-17 signaling pathway     124988890    04664 Fc epsilon RI signaling pathway     124988890   09152 Endocrine system    04920 Adipocytokine signaling pathway     124988890   09158 Development and regeneration    04380 Osteoclast differentiation     124988890  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     124988890   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124988890    05170 Human immunodeficiency virus 1 infection     124988890    05161 Hepatitis B     124988890    05160 Hepatitis C     124988890    05171 Coronavirus disease - COVID-19     124988890    05164 Influenza A     124988890    05168 Herpes simplex virus 1 infection     124988890    05163 Human cytomegalovirus infection     124988890    05169 Epstein-Barr virus infection     124988890    05165 Human papillomavirus infection     124988890   09171 Infectious disease: bacterial    05132 Salmonella infection     124988890    05135 Yersinia infection     124988890    05133 Pertussis     124988890    05134 Legionellosis     124988890    05152 Tuberculosis     124988890   09174 Infectious disease: parasitic    05146 Amoebiasis     124988890    05144 Malaria     124988890    05145 Toxoplasmosis     124988890    05140 Leishmaniasis     124988890    05142 Chagas disease     124988890    05143 African trypanosomiasis     124988890   09163 Immune disease    05310 Asthma     124988890    05322 Systemic lupus erythematosus     124988890    05323 Rheumatoid arthritis     124988890    05321 Inflammatory bowel disease     124988890    05330 Allograft rejection     124988890    05332 Graft-versus-host disease     124988890   09164 Neurodegenerative disease    05010 Alzheimer disease     124988890    05014 Amyotrophic lateral sclerosis     124988890    05020 Prion disease     124988890    05022 Pathways of neurodegeneration - multiple diseases     124988890   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124988890    05418 Fluid shear stress and atherosclerosis     124988890    05410 Hypertrophic cardiomyopathy     124988890    05414 Dilated cardiomyopathy     124988890   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     124988890    04940 Type I diabetes mellitus     124988890    04936 Alcoholic liver disease     124988890    04932 Non-alcoholic fatty liver disease     124988890    04931 Insulin resistance     124988890    04933 AGE-RAGE signaling pathway in diabetic complications     124988890   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     124988890  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124988890    00536 Glycosaminoglycan binding proteins [BR:ncar00536]     124988890 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Tumor necrosis fators    124988890 Glycosaminoglycan binding proteins [BR:ncar00536]  Heparan sulfate / Heparin   Cytokines    124988890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF DUF956 Motif Other DBs NCBI-GeneID:  124988890 NCBI-ProteinID:  XP_047414667 LinkDB All DBs Position 7:complement(122912119..122914830) Genome browser AA seq 232 aa AA seqDB search MSTESMIRDVELAEEALPKKPWGPQGSTRCLCLSLFSFLLVAAATTLFCLLHFGVIGPQR EESQNNPSLSAQAQMLTLRSSSQNMNDKPVAHVVANQTEEQLQWLSRRANALLANGMELI DNQLVVPADGLYLIYSQVLFKGQGCSSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKES LEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggctgaggaggcgctccccaagaag ccatggggcccccagggctccacccgttgcctgtgcctcagtctcttctccttcctgctt gtggcagcagccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg gaagagtcccagaataacccctctctcagtgcccaggcccagatgctcacactcagatca tcttctcaaaacatgaatgacaagcctgtagcccatgttgtagcaaaccaaaccgaggag cagctgcagtggctgagccgacgtgccaatgctctcctggccaatggcatggagctgata gacaaccagctggtggtacctgcagacgggctatacctcatctactcccaggtcctcttc aagggccaaggctgctcctcctacgtgctcctcactcacactgtcagccgctttgctgta tcttaccaggacaaggtcaacctactctctgccatcaagagcccctgcccaaaggaaagc ctggagggggctgagttcaagccctggtatgagcccatctatctgggaggggtcttcgag ctgcagaagggtgatcgactcagtgctgaggtcaacctgcccagctatctcgactttgct gagtccggacaggtctactttggggtcattgccctgtga

DBGET integrated database retrieval system