Sciurus carolinensis (gray squirrel): 124992704 Help Entry 124992704         CDS       T08117                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar00670   One carbon pool by folate ncar00790   Folate biosynthesis ncar01100   Metabolic pathways ncar01240   Biosynthesis of cofactors ncar01523   Antifolate resistance ncar04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:ncar00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     124992704    00670 One carbon pool by folate     124992704  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     124992704  09160 Human Diseases   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     124992704 Enzymes [BR:ncar01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      124992704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  124992704 NCBI-ProteinID:  XP_047419829 LinkDB All DBs Position 9:135814254..135815022 Genome browser AA seq 150 aa AA seqDB search MTTTPSVEGKQNLVIMGKKTWFSIPEKNRPLKDRINIVLSRDRKELPQAAHFLANSLNDA LKLTEQPELASKVDMVWIVGGSSVYKEAMNQPGHIKLFVTRITQEFESDTFFPEIDLEKY KLLPEYPGVLSEVQEEKGIKYKFEVYEKND NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgaccacgaccccttcagtagaaggtaaacagaatctggtgattatgggtaagaaaacc tggttctctattcctgagaagaatcgacctttaaaggacagaattaacatagttctcagt agagatcgcaaggaacttccacaagcagctcattttcttgccaacagtctgaacgatgcc ttaaaacttactgagcagccagaattagcaagtaaagtagacatggtttggatagtagga ggcagttctgtttataaggaagccatgaatcaaccaggtcatattaaactgtttgtgaca agaatcacgcaggaatttgaaagtgacacattttttccagaaattgatttggagaaatat aaacttcttccagaatacccaggtgttctttctgaggtccaggaggagaaaggcattaag tacaaatttgaagtatatgaaaaaaatgattaa

DBGET integrated database retrieval system