Notothenia coriiceps (black rockcod): 104957496 Help Entry 104957496         CDS       T04920                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc00670   One carbon pool by folate ncc00790   Folate biosynthesis ncc01100   Metabolic pathways ncc01240   Biosynthesis of cofactors ncc04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:ncc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104957496    00670 One carbon pool by folate     104957496  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104957496 Enzymes [BR:ncc01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104957496 SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Beta-prop_RSE1_2nd YidX_N Motif Other DBs NCBI-GeneID:  104957496 NCBI-ProteinID:  XP_010783435 UniProt:  A0A6I9P747 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MSRMLNAIVAVCPDLGIGMDGQLPWHPVRLNNEFKHFRKMTATPSVEGKQNVVIMGRKTW FSIPEKNRPLNNRINIVLSRECRYVSHT NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcccgcatgctgaacgctatcgtggcggtgtgtcctgacctgggcatcgggatggac gggcaattgccctggcatccagttagactcaataacgaattcaaacatttccgtaagatg acagcgacgccctctgtggaaggcaagcagaatgtggtgataatgggcaggaaaacatgg ttttccatcccagagaagaacagacccctaaacaacaggatcaatatcgtcctcagcagg gagtgcaggtatgtgtcacacaca

DBGET integrated database retrieval system