Naumovozyma castellii: NCAS_0C04480 Help Entry NCAS_0C04480      CDS       T02233                                  Symbol NCAS0C04480 Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ncs  Naumovozyma castellii Pathway ncs03420   Nucleotide excision repair ncs04111   Cell cycle - yeast ncs04120   Ubiquitin mediated proteolysis ncs04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ncs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     NCAS_0C04480 (NCAS0C04480)    04120 Ubiquitin mediated proteolysis     NCAS_0C04480 (NCAS0C04480)   09124 Replication and repair    03420 Nucleotide excision repair     NCAS_0C04480 (NCAS0C04480)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     NCAS_0C04480 (NCAS0C04480)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ncs04121]     NCAS_0C04480 (NCAS0C04480)    03400 DNA repair and recombination proteins [BR:ncs03400]     NCAS_0C04480 (NCAS0C04480) Enzymes [BR:ncs01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      NCAS_0C04480 (NCAS0C04480) Ubiquitin system [BR:ncs04121]  Ubiquitin ligases (E3)   UBL E3 ligases    NCAS_0C04480 (NCAS0C04480)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      NCAS_0C04480 (NCAS0C04480)    Cul2 complex      NCAS_0C04480 (NCAS0C04480)    Cul3 complex      NCAS_0C04480 (NCAS0C04480)    Cul4 complex      NCAS_0C04480 (NCAS0C04480)    Cul7 complex      NCAS_0C04480 (NCAS0C04480)    Cul8 complex      NCAS_0C04480 (NCAS0C04480)    Cul9 complex      NCAS_0C04480 (NCAS0C04480) DNA repair and recombination proteins [BR:ncs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       NCAS_0C04480 (NCAS0C04480)     TCR (transcription coupled repair) factors      Cul4-CSA complex       NCAS_0C04480 (NCAS0C04480) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-C3HC4_4 Motif Other DBs NCBI-GeneID:  11527823 NCBI-ProteinID:  XP_003675802 UniProt:  G0VD76 LinkDB All DBs Position 3:919123..919452 Genome browser AA seq 109 aa AA seqDB search MSDLDKMDIDTETENTTQQKKKFEIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPK AMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgagcgatcttgataagatggatatcgacacagaaactgaaaacacaacacagcaaaag aagaaatttgaaatcaagaaatggaccgcagtggcgttttggtcgtgggatatagctgtt gataactgcgctatctgtagaaatcatattatggaaccatgtattgaatgtcaaccgaaa gctatgacggatacagataatgagtgtgttgctgcatgggggacatgtaatcatgccttc catttacattgtattaataaatggattaaaacgagggatgcatgtcctctagataatcaa ccatggcagttagcaagatgtggcaggtag

DBGET integrated database retrieval system