Neodiprion fabricii: 124176580 Help Entry 124176580         CDS       T08986                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism nfb  Neodiprion fabricii Pathway nfb00510   N-Glycan biosynthesis nfb00513   Various types of N-glycan biosynthesis nfb04141   Protein processing in endoplasmic reticulum Module nfb_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:nfb00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     124176580    00513 Various types of N-glycan biosynthesis     124176580  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124176580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Pox_E2-like Motif Other DBs NCBI-GeneID:  124176580 NCBI-ProteinID:  XP_046414006 LinkDB All DBs Position 2:complement(3749220..3750617) Genome browser AA seq 80 aa AA seqDB search MIEIESMTRYVSPINPAVFPHLAVVLLGIGIFFTAWFFVYEVTSTKFTRDIFKELLVSLV AAIFSGFGVLFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgattgaaatcgagtccatgacgaggtacgtctcaccgataaacccagctgtgtttcca catttggctgtagtcctgttaggaatcggtatattctttaccgcgtggtttttcgtctac gaagtaaccagcaccaagtttaccagagacatattcaaggaattgctggtctccttagta gctgcaatattctccggtttcggtgtactgtttctactgctttgggtcggaatttatgtt tag

DBGET integrated database retrieval system