Nannochloropsis gaditana: NGA_0491920 Help Entry NGA_0491920       CDS       T02917                                  Name (RefSeq) protein nef1   KO K26502   transmembrane protein 258 Organism ngd  Nannochloropsis gaditana Pathway ngd00510   N-Glycan biosynthesis ngd00513   Various types of N-glycan biosynthesis ngd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ngd00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     NGA_0491920    00513 Various types of N-glycan biosynthesis     NGA_0491920  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     NGA_0491920 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  17361467 NCBI-ProteinID:  XP_005854694 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MSSQTPYYSPVNPAAFGTLALILIGSGLSFMALFFVYEMKVSHDHKSRSLVKELFMATLS SLLLGCGTLFLTLWAGVFV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcctcccagaccccgtactatagccccgttaatccagcggctttcggcacgctagcc ttgattctgatcgggtctggtttgtccttcatggccttattttttgtgtacgagatgaag gtctcgcacgaccacaagagccgctccctggtcaaggagcttttcatggccaccctgtcc tccctcctcctcggctgtggcaccctcttcctgacgctctgggcgggcgtctttgtgtag

DBGET integrated database retrieval system