Nannochloropsis gaditana: NGA_2043800 Help Entry NGA_2043800       CDS       T02917                                  Name (RefSeq) glutathione synthetase   KO K21456   glutathione synthase [EC:6.3.2.3] Organism ngd  Nannochloropsis gaditana Pathway ngd00270   Cysteine and methionine metabolism ngd00480   Glutathione metabolism ngd01100   Metabolic pathways ngd01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ngd00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     NGA_2043800   09106 Metabolism of other amino acids    00480 Glutathione metabolism     NGA_2043800  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ngd04147]     NGA_2043800 Enzymes [BR:ngd01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.2  Acid-D-amino-acid ligases (peptide synthases)     6.3.2.3  glutathione synthase      NGA_2043800 Exosome [BR:ngd04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    NGA_2043800 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GSH_synthase Motif Other DBs NCBI-GeneID:  17362956 NCBI-ProteinID:  XP_005856181 UniProt:  I2CQH2 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search LFDQRFLELALWEKHGLQVVRLSLEEVARRCRLAPGPTQALWLDGRHELAVVYFRAGYTP ADFGSPLAWDARLLIEASAAVKCPTLGYQLAGTKK NT seq 287 nt NT seq  +upstreamnt  +downstreamnt cctctttgaccagcggtttttggagctggccctgtgggagaagcacggcctgcaggttgt gcgactctctcttgaggaagtcgctcgccgctgccgcctggccccggggccgacgcaggc gctctggctggacggcaggcacgagctggcggttgtctacttccgagcgggctacacccc ggccgacttcggttccccgcttgcgtgggatgccaggctactcatcgaggcctcggccgc ggtcaagtgccccaccttgggctatcagctcgcggggaccaaaaaag

DBGET integrated database retrieval system