Naegleria gruberi: NAEGRDRAFT_5552 Help Entry NAEGRDRAFT_5552   CDS       T01241                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ngr  Naegleria gruberi Pathway ngr03420   Nucleotide excision repair ngr04120   Ubiquitin mediated proteolysis ngr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ngr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     NAEGRDRAFT_5552    04120 Ubiquitin mediated proteolysis     NAEGRDRAFT_5552   09124 Replication and repair    03420 Nucleotide excision repair     NAEGRDRAFT_5552  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ngr04121]     NAEGRDRAFT_5552    03400 DNA repair and recombination proteins [BR:ngr03400]     NAEGRDRAFT_5552 Enzymes [BR:ngr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      NAEGRDRAFT_5552 Ubiquitin system [BR:ngr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    NAEGRDRAFT_5552   Multi subunit type E3    SCF complex     Ring finger protein      NAEGRDRAFT_5552    Cul2 complex      NAEGRDRAFT_5552    Cul3 complex      NAEGRDRAFT_5552    Cul4 complex      NAEGRDRAFT_5552    Cul7 complex      NAEGRDRAFT_5552    Cul8 complex      NAEGRDRAFT_5552    Cul9 complex      NAEGRDRAFT_5552 DNA repair and recombination proteins [BR:ngr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       NAEGRDRAFT_5552     TCR (transcription coupled repair) factors      Cul4-CSA complex       NAEGRDRAFT_5552 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 Motif Other DBs NCBI-GeneID:  8858761 NCBI-ProteinID:  XP_002678405 JGI:  Naegr1_5552 UniProt:  D2VBZ5 LinkDB All DBs AA seq 90 aa AA seqDB search KKRFEVKKWNAVALWGWDIVVDSCAICRNHIMELCIECTANQQSATSEECTVAWGVCNHA FHFHCISRWLKTRHVCPLCNCEWDFQKYGK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt aagaaacgattcgaagtgaagaagtggaacgctgttgctttgtggggttgggatatcgtc gtcgactcttgtgctatttgtcgtaaccacatcatggaactttgtattgaatgtactgct aaccaacaatctgccaccagtgaagaatgtaccgttgcttggggtgtttgtaatcacgct ttccacttccactgtatttcaagatggttaaagaccagacacgtttgcccattgtgtaac tgcgaatgggatttccaaaagtacggaaaa

DBGET integrated database retrieval system