Fusarium vanettenii: NECHADRAFT_42915 Help Entry NECHADRAFT_42915  CDS       T01612                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nhe  Fusarium vanettenii Pathway nhe03420   Nucleotide excision repair nhe04111   Cell cycle - yeast nhe04120   Ubiquitin mediated proteolysis nhe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nhe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     NECHADRAFT_42915    04120 Ubiquitin mediated proteolysis     NECHADRAFT_42915   09124 Replication and repair    03420 Nucleotide excision repair     NECHADRAFT_42915  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     NECHADRAFT_42915  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nhe04121]     NECHADRAFT_42915    03400 DNA repair and recombination proteins [BR:nhe03400]     NECHADRAFT_42915 Enzymes [BR:nhe01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      NECHADRAFT_42915 Ubiquitin system [BR:nhe04121]  Ubiquitin ligases (E3)   UBL E3 ligases    NECHADRAFT_42915   Multi subunit type E3    SCF complex     Ring finger protein      NECHADRAFT_42915    Cul2 complex      NECHADRAFT_42915    Cul3 complex      NECHADRAFT_42915    Cul4 complex      NECHADRAFT_42915    Cul7 complex      NECHADRAFT_42915    Cul8 complex      NECHADRAFT_42915    Cul9 complex      NECHADRAFT_42915 DNA repair and recombination proteins [BR:nhe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       NECHADRAFT_42915     TCR (transcription coupled repair) factors      Cul4-CSA complex       NECHADRAFT_42915 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  9672073 NCBI-ProteinID:  XP_003045294 JGI:  42915 UniProt:  C7Z9Y0 LinkDB All DBs Position 6 AA seq 112 aa AA seqDB search MSDAPGAVAKKVEGSSSKAVEGRKKFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC QANQASATSEECTVAWGICNHAFHFHCISRWLKARSVCPLDNRDWEFQKYGR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgcgcctggcgccgtcgccaagaaggtcgagggttccagcagcaaggctgtc gagggcaggaagaagttcgaggtcaagaagtggaatgccgttgctctttgggcttgggac attgtcgtcgacaactgcgccatttgccgaaaccacatcatggacctttgcattgaatgc caggccaaccaggcgtctgccactagcgaggagtgcactgtggcatggggtatttgcaac catgctttccatttccactgcatttcacgatggctaaaggcccgatctgtttgcccattg gacaacagagactgggagttccagaagtacggacgatga

DBGET integrated database retrieval system