Nilaparvata lugens (brown planthopper): 111055961 Help Entry 111055961         CDS       T07276                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism nlu  Nilaparvata lugens (brown planthopper) Pathway nlu00510   N-Glycan biosynthesis nlu00513   Various types of N-glycan biosynthesis nlu04141   Protein processing in endoplasmic reticulum Module nlu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:nlu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     111055961    00513 Various types of N-glycan biosynthesis     111055961  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111055961 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB CAAD Motif Other DBs NCBI-GeneID:  111055961 NCBI-ProteinID:  XP_022198957 LinkDB All DBs Position 6:complement(6954748..6958948) Genome browser AA seq 108 aa AA seqDB search MLVELIQRSRLFSFLSRRHVLLIIIYFTMVQIELMTRYVSPINPAVFPHLTIILLGIGIF FTAWFFVYEVTSTKLTRDPFKELLVSLVAAMFSGFGVLFLLLWVGIYV NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgttggtagaactgatacaacgtagccggctgtttagctttctgtcaaggagacacgta ctgcttattattatctacttcacaatggtacaaatcgaattaatgacgagatatgtctcg ccaatcaacccggcagtatttcctcacctcaccatcattctattagggatcggaatcttc ttcaccgcctggtttttcgtctacgaagtgacgagcacaaaactcacgagggaccctttc aaagagctactagtatcattagttgcagctatgttttctggcttcggagtgctgttcctt ctattatgggttggaatatacgtttga

DBGET integrated database retrieval system