KEGG   Natronomonas moolapensis: Nmlp_2357
Entry
Nmlp_2357         CDS       T02478                                 

Symbol
aceB
Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
nmo  Natronomonas moolapensis
Pathway
nmo00630  Glyoxylate and dicarboxylate metabolism
nmo01100  Metabolic pathways
nmo01120  Microbial metabolism in diverse environments
nmo01200  Carbon metabolism
Module
nmo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmlp_2357 (aceB)
Enzymes [BR:nmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     Nmlp_2357 (aceB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Nmlp_2357 (aceB)
SSDB
Motif
Pfam: HpcH_HpaI DUF5818 Ntox5 Marek_A
Other DBs
NCBI-ProteinID: CCQ36525
UniProt: M1XQT9
LinkDB
Position
1297934..1299244
AA seq 436 aa
MTELDKRTHERTFVRTFFTTPTAVEGEDDSAKMLEGAAGLSGMEAPDVWVPDNEDATAPN
MRDEGAQNIIDVVSEHGADYPGEIHPRVVWHRDSPSTRYQGFQRMLEIADPENGAIEHID
GFVVPEVGDIDDWKKADEFLTIIENEYGFDEGSIKMSVIIESGQSELGMEKLRDEMGKPT
NNLERLFMLVIGEVDYTKDARAITPTGALPAWPELRHNTSRAASAAGLISVDGPYDDIRD
VEGYRERMTDNQAKGMLGIWSLTPGQVVEANKSALPPAEGYWLLDADGREVELESVDGVE
VYDGDRVSLEETDGGYVLSVGTDDLELDEDELTQELLDLLDYVPSMDDIVDSMEEFEAAK
EAGKGAIAMTQAATVEIDGVQVDISSDRMWDEATYQALQTPITLFQDVYENRPDQHEGLA
ELYSEDVVERAMDVGN
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgacggaactcgacaagcgaacccacgagcggacgttcgtccggaccttctttaccacc
ccgacggcggtcgaaggcgaggacgactcggcgaagatgctggaaggtgccgcgggcctc
agcgggatggaggcacccgacgtctgggtgccggacaacgaggacgccaccgcgccgaac
atgcgcgacgagggcgcacagaacatcatcgacgtcgtctccgaacacggcgccgactac
cccggcgagatccacccgcgcgtcgtctggcaccgcgatagcccctcgacgcggtatcag
ggcttccaacgcatgctcgagatcgcagaccccgagaacggagccatcgagcacatcgac
gggttcgtcgtccccgaggtcggcgacatcgacgactggaaaaaagccgacgagttcctg
acgatcatcgagaacgagtacggcttcgatgagggctcgatcaagatgtccgtcatcatc
gagagcggccagtccgaactcggtatggagaagctccgcgacgagatgggcaagccgacg
aacaacctcgagcgcctgttcatgctcgtgatcggcgaggtcgactacacgaaggacgcc
cgcgccatcacgccgacgggcgcgctgccggcgtggcccgaactccgtcacaacacctcc
cgtgcggcgagcgccgcggggctcatttccgtcgacggtccctacgacgacatccgcgac
gtcgagggctaccgagagcgcatgaccgacaaccaggccaagggaatgctcggcatctgg
tcgctcacccccgggcaggtcgtcgaggccaacaagtccgcgctcccgcccgcggagggc
tactggcttctcgacgccgacggccgcgaggtcgaactcgaaagcgtcgacggcgtcgaa
gtgtatgacggagaccgcgtctccctcgaggagaccgacggcggctacgtcctctcggtc
ggcaccgacgacctcgaactcgacgaggacgaactcacgcaggagttgctcgacctcctc
gattacgttccgagcatggacgacatcgtcgactccatggaggagttcgaggccgccaag
gaggccggcaagggcgcgatcgcgatgacccaggccgcgaccgtcgaaatcgacggcgtg
caggtcgatatcagcagcgatcggatgtgggacgaggccacctaccaggcgcttcagacc
ccgatcacgctgttccaggacgtctacgagaaccgccccgaccaacacgaggggctcgcc
gaactctacagcgaggacgtcgtcgagcgcgcgatggacgtcgggaactga

DBGET integrated database retrieval system