KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0236
Entry
NMAA_0236         CDS       T01931                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase (3-ketoacyl-acyl carrier protein reductase)
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00061  Fatty acid biosynthesis
nmw00780  Biotin metabolism
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01212  Fatty acid metabolism
nmw01240  Biosynthesis of cofactors
Module
nmw_M00083  Fatty acid biosynthesis, elongation
nmw_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nmw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMAA_0236 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMAA_0236 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NMAA_0236 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nmw01004]
    NMAA_0236 (fabG)
Enzymes [BR:nmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     NMAA_0236 (fabG)
Lipid biosynthesis proteins [BR:nmw01004]
 Fatty acid synthase
  Component type
   NMAA_0236 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase SDR 2-Hacid_dh_C ADH_zinc_N CHASE2
Other DBs
NCBI-ProteinID: CBY90077
LinkDB
Position
complement(279112..279858)
AA seq 248 aa
MSTQDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGGEGR
ALDSAEPETIESLIADIEKAFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFR
ASKAVLRGMMKQRSGRIINITSVVGVMGNAGQTNYAAAKAGLIGFAKSMAREVGSRGITV
NCVAPGFIDTDMTRALPEETRQAFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLH
VNGGMLMP
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagcacacaagatttaagcggcaaaatcgctttggtaaccggcgcctcgcgcggtatc
ggtgcagcaattgccgacacactggcggcagccggtgccaaagtcatcggtacggcgacc
agtgagagcggtgcggcggcgattagcgagcggttggcgcaatggggcggcgaaggccgt
gcattggattccgccgaacctgaaaccatcgaaagcctgattgccgacatcgaaaaagca
ttcggcaaactcgacattctggtcaacaacgctggcatcacccgcgacaacctcctgatg
cgtatgaaagaagaagagtgggacgacatcatgcaggtcaacctcaaatccgtcttccgc
gcttctaaagccgtcttgcgcggcatgatgaaacaacgttccggccgcatcatcaacatc
acatccgtcgtcggcgtgatgggcaatgccgggcaaaccaactacgccgccgccaaagca
ggcttaatcggttttgccaaatccatggcgcgcgaagtcggcagccggggcattaccgtc
aactgcgtcgcccccggctttatcgataccgatatgacccgcgccctgccggaagaaacc
cgccaagcctttaccgcccaaaccgccttgggcagattcggcgacgcgcaagacattgcc
gatgcagtcttgttcttggcttccgatcaggcaaaatacattaccggtcaaacgctgcac
gtcaacggcggcatgctgatgccctga

DBGET integrated database retrieval system