Nipponia nippon (crested ibis): 104021538 Help Entry 104021538         CDS       T05756                                  Name (RefSeq) protein max   KO K04453   Max protein Organism nni  Nipponia nippon (crested ibis) Pathway nni03083   Polycomb repressive complex nni04010   MAPK signaling pathway Brite KEGG Orthology (KO) [BR:nni00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     104021538  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104021538  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:nni03000]     104021538    03036 Chromosome and associated proteins [BR:nni03036]     104021538 Transcription factors [BR:nni03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     104021538 Chromosome and associated proteins [BR:nni03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      104021538 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  JetA bZIP_2 Spc29 JAKMIP_CC3 SlyX DUF4763 DUF7801 PUMA_CC HLH GAGA_bind CCDC106 DUF4140 XhlA DivIC ZapB Motif Other DBs NCBI-GeneID:  104021538 NCBI-ProteinID:  XP_009473384 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search ASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQANYPS TDNSLYTNPKGSTISAFDGGSDSSSDSEPDEPQSRKKLRMEAS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt gcatcccgggcccaaatcctggacaaagccacagagtacatccagtacatgcgccggaaa aaccacacgcaccagcaggacatcgacgacctcaagcggcagaacgctctcctggagcag caagtacgcgcgctggagaaagcccggtcgagcgcccagctgcaagccaactacccctcg acggacaacagcctctacaccaaccccaagggcagcaccatctccgctttcgacggtggc tccgactccagctccgactcggagcccgatgagccgcagagcaggaagaagctgcgcatg gaggccagttag

DBGET integrated database retrieval system