Nestor notabilis (Kea): 104402868 Help Entry 104402868         CDS       T08494                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism nnt  Nestor notabilis (Kea) Pathway nnt03260   Virion - Human immunodeficiency virus nnt03264   Virion - Flavivirus and Alphavirus nnt03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus nnt03273   Virion - Lassa virus and SFTS virus nnt04145   Phagosome nnt04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:nnt00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     104402868    03264 Virion - Flavivirus and Alphavirus     104402868    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     104402868    03273 Virion - Lassa virus and SFTS virus     104402868  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104402868  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104402868  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nnt04131]     104402868   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:nnt04054]     104402868    04090 CD molecules [BR:nnt04090]     104402868    04091 Lectins [BR:nnt04091]     104402868 Membrane trafficking [BR:nnt04131]  Endocytosis   Phagocytosis    C-lectin receptors     104402868 Pattern recognition receptors [BR:nnt04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    104402868 CD molecules [BR:nnt04090]  Proteins   104402868 Lectins [BR:nnt04091]  C-Type lectins   Asialoglycoprotein and DC receptors    104402868 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  104402868 NCBI-ProteinID:  XP_010009154 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MEEEHLHDDLQAFKDRNFFRLKLRPFVTIYLLLALSFLLTFTLFAVSLSRVSAISSKLQE VPPEQRRNVSGRDFLLFPCGPGSREWEYFDGKCYYFSLTRTSWHKAKAQCEEMHSQLAVI NSYAKQNFVMFRTRNERFWIGLTDEDSEGEWEWVDGTDYRTTFTFWMEGEPNNSGNNEDC AHVWVSGKWNDVYCTYECYYICEKPVPK NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggaagaggaacatctgcatgatgatctgcaggcttttaaagacagaaacttcttcagg ctgaagctgaggccctttgtcaccatctacttgctgctggccctctccttcctgctcacc ttcaccctctttgccgtgtcgctctccagagtttcagccatttcttccaagctccaggag gtgcccccggagcagagacgcaacgtttcgggcagggatttcctcttgtttccctgcgga cccggatccagggaatgggaatactttgatggaaaatgttactacttctccctcaccaga acgagctggcacaaggcgaaggctcagtgcgaggagatgcactcgcagctcgctgtcatt aacagctatgccaagcagaattttgtcatgttcaggacaaggaatgagcgtttctggatt gggctcacggatgaggactcagaaggggaatgggaatgggtggacgggaccgactacaga accacgttcacattttggatggagggagagcccaataacagcggcaacaatgaggactgt gcccatgtctgggtgtcggggaagtggaacgatgtctactgcacctacgagtgctactac atctgcgagaagcctgtgcccaagtga

DBGET integrated database retrieval system