Nestor notabilis (Kea): 104412395 Help Entry 104412395         CDS       T08494                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism nnt  Nestor notabilis (Kea) Pathway nnt00670   One carbon pool by folate nnt00790   Folate biosynthesis nnt01100   Metabolic pathways nnt01240   Biosynthesis of cofactors nnt04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:nnt00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104412395 (DHFR)    00670 One carbon pool by folate     104412395 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104412395 (DHFR) Enzymes [BR:nnt01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104412395 (DHFR) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-GeneID:  104412395 NCBI-ProteinID:  XP_010021415 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTSTSQVEGKQNALIMGKKTWFSIPEKNRPLKDRINIVLSRELKETPKGAHYLSRSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFVTRILQEFESDTFFPEINYKDY KLLTEYPGVPADIQEENGIQYKFEVYEKAVLAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgactagcacatcccaagtggaaggtaaacagaatgcattgataatgggtaaaaaaacg tggttctccattcctgagaagaatcgtcctctaaaagacagaattaatatagtgctcagc agggagctcaaggaaaccccaaaaggagcgcattatctttccagaagtctggatgatgct ttagctcttttggattcaccagagttaaaaagtaaagtagacatggtctggatcgttgga ggcacttcagtttacaaggcagcaatggagaagccaattaatcaccgattgtttgtgaca agaattttgcaggaatttgaaagtgacacattttttccggaaatcaactacaaagactac aaacttcttacggagtacccaggcgtccctgctgatatccaagaagagaatggcattcag tacaaatttgaagtgtacgaaaaagctgtcctggcacaataa

DBGET integrated database retrieval system