Nelumbo nucifera (sacred lotus): 104600540 Help Entry 104600540         CDS       T04131                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nnu  Nelumbo nucifera (sacred lotus) Pathway nnu03420   Nucleotide excision repair nnu04120   Ubiquitin mediated proteolysis nnu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nnu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104600540    04120 Ubiquitin mediated proteolysis     104600540   09124 Replication and repair    03420 Nucleotide excision repair     104600540  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nnu04121]     104600540    03400 DNA repair and recombination proteins [BR:nnu03400]     104600540 Enzymes [BR:nnu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104600540 Ubiquitin system [BR:nnu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104600540   Multi subunit type E3    SCF complex     Ring finger protein      104600540    Cul2 complex      104600540    Cul3 complex      104600540    Cul4 complex      104600540    Cul7 complex      104600540    Cul8 complex      104600540    Cul9 complex      104600540 DNA repair and recombination proteins [BR:nnu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104600540     TCR (transcription coupled repair) factors      Cul4-CSA complex       104600540 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  104600540 NCBI-ProteinID:  XP_010261838 UniProt:  A0A1U8AHB4 LinkDB All DBs Position Un AA seq 120 aa AA seqDB search MASLDTDINMIPVGEGSSGAGPSSSSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcatccctggacactgatatcaacatgattccggtcggcgagggctccagtggagct ggtccatcgtcttcgtcgtcgacgaagaagccgaagcgtttcgagatcaagaagtggaat gcagtcgctctttgggcatgggatatcgtcgtggataactgtgctatttgcaggaaccac atcatggatctatgtatcgagtgccaagctaatcaagcgagcgcaacaagcgaggagtgc acggtggcttggggtgtatgcaaccatgcgttccacttccattgcatcagccgatggctc aaaacccgtcaagtttgcccactggataacagcgagtgggaatttcagaagtatggccac tag

DBGET integrated database retrieval system