Neobacillus oceani: V1499_01690
Help
Entry
V1499_01690 CDS
T11220
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
noce Neobacillus oceani
Pathway
noce03030
DNA replication
noce03410
Base excision repair
noce03420
Nucleotide excision repair
noce03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
noce00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
V1499_01690 (ligA)
03410 Base excision repair
V1499_01690 (ligA)
03420 Nucleotide excision repair
V1499_01690 (ligA)
03430 Mismatch repair
V1499_01690 (ligA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
noce03032
]
V1499_01690 (ligA)
03400 DNA repair and recombination proteins [BR:
noce03400
]
V1499_01690 (ligA)
Enzymes [BR:
noce01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
V1499_01690 (ligA)
DNA replication proteins [BR:
noce03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
V1499_01690 (ligA)
DNA repair and recombination proteins [BR:
noce03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
V1499_01690 (ligA)
NER (nucleotide excision repair)
GGR (global genome repair) factors
V1499_01690 (ligA)
MMR (mismatch excision repair)
DNA ligase
V1499_01690 (ligA)
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
V1499_01690 (ligA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
HHH_5
DNA_ligase_ZBD
Nlig-Ia
PTCB-BRCT
HHH
RNA_pol_A_CTD
5_3_exonuc
BRCT_2
RNA_ligase
PG_binding_1
Motif
Other DBs
NCBI-ProteinID:
XOL51491
LinkDB
All DBs
Position
310967..312970
Genome browser
AA seq
667 aa
AA seq
DB search
MDLQQAEMKVRELQTLLHQYGYEYYVLDKPSVPDAEYDRLLRELIELEEKYPQFKTPDSP
TVRVGGAILDMFEKVRHKSPMLSLGNAFNEVDLRDFDRRVRQAAGNDVSYVCELKIDGLA
VALTYEEGRFVLGSTRGDGTTGEDITANLRTIKSIPLRLRESASLEVRGEAFMPRKSFEK
LNKLKEERGEEPFANPRNAAAGSLRQLDTSIAASRNLDIFLYGISDAQDLEIGSHSEALD
YLDRLGFKTNKERRKCASIEDVIDYIDGWVEKRANLDYDIDGIVIKVDSLETQEQLGTTA
KSPRWAVAYKFPAEEVVTTLLDIELSVGRTGVVTPTAILEPVRVAGTTVQRASLHNEDLI
REKDLKIGDKVVVKKAGDIIPEVVNVLLEQRTGNETDFHMPTHCPECESDLVRLEGEVAL
RCLNPKCPAQIREGLIHFVSRNAMNIDGLGEKVIAQLFAHKLVEDVADLYKLTAEELLAL
ERMGEKSVANLLQAIDRSKENSLERLLFGLGIRHVGEKAARTLAQEFETMDRLASATESD
LMSINEVGEKMASSIAAFFEQEEARELINELKAAGVNMEYLGPKRAAIESADSIFTGKTV
VLTGKMERMSRNEAKEKLEALGANVAGSVSKKTDILIAGEDAGSKLTKAQELGIEIWDEE
RLLEEIE
NT seq
2004 nt
NT seq
+upstream
nt +downstream
nt
atggacctgcaacaagccgaaatgaaagtcagggagctgcagacattgctgcatcaatat
ggatacgaatattatgttctcgataaaccgtcagtcccggatgcggaatatgaccggctc
cttcgtgaattaattgaactggaggaaaagtatccacaattcaaaacgcctgattcgcca
acggtcagggttggcggcgccattcttgatatgtttgaaaaggttcggcacaaaagcccg
atgctaagcttggggaatgcgttcaatgaagtcgatctccgggattttgaccggcgtgtc
cggcaggcagcggggaatgatgtcagctatgtatgtgagttaaaaatcgacggccttgcc
gttgccctgacttatgaagaggggcgattcgtccttggctctacacggggcgatggtacg
actggcgaggacattaccgcgaatttgcggaccattaaatcaattcctctcaggttaagg
gagagcgcctcccttgaggtacgcggggaagccttcatgccgagaaagtcttttgaaaag
ctcaacaagctgaaggaagaacgcggcgaggaaccgttcgcgaatccaaggaacgcggcg
gccggctcacttaggcagctggatacaagcattgccgcatccaggaatcttgatattttc
ctctatgggatttctgatgcgcaggaccttgaaatcggatcgcatagcgaagctcttgac
tatctcgacaggcttgggtttaaaacgaacaaggaacggcgaaaatgcgcgtcgattgaa
gatgtcatcgactatatagacgggtgggtcgaaaagcgcgcgaatcttgattatgacatt
gacggcatcgttatcaaagtcgactcactcgagacgcaggagcagctcggtacaacggct
aaaagcccgcgctgggcggttgcatacaaatttccggctgaggaagtggttacgaccctt
ttggatattgagctgagcgttggacggactggggtcgttacacctaccgccatcctcgag
ccagtaagggtcgcaggaacgactgttcagcgggcatccctgcacaacgaagatttaatc
agggagaaggatttgaagattggcgataaagtagttgttaaaaaggccggggatattatt
ccggaagttgtaaacgtccttttggagcagcgaaccggcaatgaaacggattttcacatg
ccaacccattgcccggaatgcgaaagcgaccttgtcaggcttgagggtgaggtggcctta
aggtgcctgaatccgaaatgcccggcacaaataagggaaggcttgatccattttgtatca
aggaatgcgatgaatatcgatggccttggagaaaaggtgattgcccagttgtttgcccat
aagcttgtggaagatgtggcggacctatataagttgaccgcggaggaactccttgcccta
gaacggatgggggaaaagagcgtggccaatttgctccaggcaattgaccgttcgaaggag
aactcgcttgagcgtttattgtttggcttgggcatccgccatgtaggggaaaaggcggcg
aggacgcttgcccaggaattcgaaacgatggaccggcttgcgtcggcaaccgaaagcgac
cttatgtccattaacgaagtaggggaaaagatggccagctcaatcgctgcgttcttcgaa
caggaagaagccagggaactgataaatgaactaaaggctgcaggcgtgaatatggaatac
ctagggccgaaacgagcggcaattgagtcggcggattcaattttcaccggaaaaacggtc
gtcctgactggtaaaatggaaagaatgtcccggaatgaagcgaaagaaaagctggaagct
ctcggcgcgaatgtagccggtagcgtcagcaaaaaaacagacatcctcattgcgggagaa
gatgcaggctccaagcttactaaagcgcaagagcttggaatcgaaatttgggatgaagag
aggctgctcgaggaaatcgaatag
DBGET
integrated database retrieval system