KEGG   Natronococcus occultus: Natoc_1323
Entry
Natoc_1323        CDS       T02426                                 

Definition
(GenBank) NAD dependent epimerase/dehydratase family
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
nou  Natronococcus occultus
Pathway
nou00053  Ascorbate and aldarate metabolism
nou01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nou00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Natoc_1323
Enzymes [BR:nou01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     Natoc_1323
SSDB
Motif
Pfam: Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_10 RmlD_sub_bind NAD_binding_4 GDP_Man_Dehyd DapB_N Semialdhyde_dh
Other DBs
NCBI-ProteinID: AGB37137
UniProt: L0JVS9
LinkDB
Position
1290229..1291029
AA seq 266 aa
MTNIAITGASGSVGREAIEALSDAELTLFSHSESEDLETTPIEISDRDAVFDALEGQDVV
IHLAANPDPRAEWDAVSEPNIEGVYNVYAAAVEHDLERVVFASSNHAVNMENTVSPTRPE
STSGQPKVVRPDEQSDPDTYYGVTKVFGEAMGQYYANRHGLDVINLRIGWLLTRDGLRDV
VANRDGAGERYARAMWLSPDDCQRVIRAAVTRSLPETPLTAHAISDNSDRFLSLSETMLE
LEYRPQDDAAAVLDEDEAARDGLETA
NT seq 801 nt   +upstreamnt  +downstreamnt
atgactaacatcgcaatcactggcgcgtccggtagcgtcgggagggaagcgattgaggcg
ctttcagacgccgaactgacgctgttctctcacagcgaatccgaggacctcgagacgacg
ccgatcgaaatcagcgatcgcgacgcggtgttcgacgctctcgagggacaggacgtcgtg
atccaccttgcagcgaacccggatccgcgcgcggagtgggatgcggtttccgaaccgaac
atcgagggagtctataacgtatatgcggccgcagtcgagcacgacctcgagcgggtcgta
ttcgcgagctcgaatcacgccgtcaacatggagaataccgtctcgccgacgcgtccggaa
tcgacgagcggtcagccgaaggtcgtcaggccggacgaacagtctgatcccgacacctac
tacggcgtaacgaaggttttcggcgaggcgatgggacagtactacgcgaaccgacacgga
ctcgacgtaatcaacctgcggatcggatggctgctcacccgcgacgggctcagggacgta
gtcgctaaccgggacggtgcgggtgagcggtacgctcgcgcgatgtggctcagtccggat
gactgtcagcgcgtcatccgtgcggcagtgacgcggtcgcttccggaaacaccgctgacc
gcccacgctatttccgacaacagtgatcggttcctctcactgtcggagacaatgctcgag
ctcgagtatcggccacaggacgacgctgcggcggttctggacgaggacgaagctgcgaga
gacgggctcgaaaccgcctga

DBGET integrated database retrieval system